Property Summary

NCBI Gene PubMed Count 20
Grant Count 9
Funding $618,430.03
PubMed Score 81.33
PubTator Score 63.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
cutaneous lupus erythematosus 2.500 0.001
psoriasis 1.300 0.001
osteosarcoma -1.963 0.029
glioblastoma 1.700 0.002
periodontitis 1.700 0.000
non-small cell lung cancer -1.054 0.000
intraductal papillary-mucinous adenoma (... 1.800 0.034
colon cancer -1.900 0.009
lung cancer -4.000 0.000
interstitial cystitis 2.200 0.000
adult high grade glioma 1.800 0.001
pilocytic astrocytoma 1.600 0.000
posterior fossa group A ependymoma 1.300 0.000
primary Sjogren syndrome 1.400 0.013
lung carcinoma -3.800 0.000
invasive ductal carcinoma 2.200 0.003
acute myeloid leukemia 1.600 0.018
ulcerative colitis 3.200 0.000
ovarian cancer 1.800 0.004

Gene RIF (8)

PMID Text
25058460 CASP has a direct role in the secretion of IFN-gamma, and NK cell motility and ability to kill tumor cells. CASP polarizes to the leading edge of migrating NK cells, and to the immunological synapse when engaged with tumor cells.
23469018 a newly identified binding partner of CYTIP, SOCS-1, and confirm its function in regulating the degradation of CYTIP by the proteasome
23223005 loss of DNA methylation enables HIF-driven cytohesin 1 interacting protein expression to protect cancer cells from death cytokine signals
21562043 on infection of human monocyte-derived dendritic cells with herpes simplex virus type 1 (HSV-1), CYTIP is rapidly degraded and as a consequence beta-2 integrins, predominantly LFA-1, are activated
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17577583 These results suggest that endosomal SNX27 may recruit CASP to orchestrate intracellular trafficking and/or signaling complexes.
16702224 Cybr not only regulates lymphocyte adhesion and cell-cell interaction but also contributes to the regulation of the signaling cascade and of the genetic program downstream of the T cell receptor.
12052827 observations suggest that CASP is a scaffolding protein that facilitates the function of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli

AA Sequence

MSLQRLLQHSSNGNLADFCAGPAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLALTRSSSLSDF      1 - 70
SWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTE     71 - 140
GFTYKQVVDLIRSSGNLLTIETLNGTMILKRTELEAKLQVLKQTLKQKWVEYRSLQLQEHRLLHGDAANC    141 - 210
PSLENMDLDELSLFGPLPGPGPALVDRNRLSSESSCKSWLSSMTMDSEDGYQTCVSEDSSRGAFSRQTST    211 - 280
DDECFIPKEGDDFLRRSSSRRNRSISNTSSGSMSPLWEGNLSSMFGTLPRKSRKGSVRKQLLKFIPGLHR    281 - 350
AVEEEESRF                                                                 351 - 359
//

Text Mined References (22)

PMID Year Title
25058460 2014 Cytohesin-associated scaffolding protein (CASP) is involved in migration and IFN-? secretion in natural killer cells.
23469018 2013 In human monocyte derived dendritic cells SOCS1 interacting with CYTIP induces the degradation of CYTIP by the proteasome.
23223005 2013 Epigenetic expansion of VHL-HIF signal output drives multiorgan metastasis in renal cancer.
21562043 2011 Infection of dendritic cells with herpes simplex virus type 1 induces rapid degradation of CYTIP, thereby modulating adhesion and migration.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20530790 2010 LFA-1 activity state on dendritic cells regulates contact duration with T cells and promotes T-cell priming.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18926288 2008 Cybr, CYTIP or CASP: an attempt to pinpoint a molecule's functions and names.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17577583 2007 Sorting nexin 27 interacts with the Cytohesin associated scaffolding protein (CASP) in lymphocytes.
More...