Knowledge Summary

Patent

No data available

Synonym

Accession O60756
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGRTPTAVQVKSFTKQGQQRRVCRDLPLKNTKNGLSPGMRTCFLYLRFFPCLSWMSLKWTQAVHCARNIV      1 - 70
LSFMLLLLLLNYNM                                                             71 - 84
//