Property Summary

NCBI Gene PubMed Count 16
Grant Count 13
R01 Count 11
Funding $748,231.46
PubMed Score 20.82
PubTator Score 17.32

Knowledge Summary

Patent (17,607)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.200 0.001
osteosarcoma 2.420 0.000
Multiple Sclerosis 1.100 0.002

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
651719 screening 1564 / 0 / 356556 Fluorescence-based cell-based primary high throughput screening assay to identify antagonists of the Galanin Receptor 3 (GalR3)
651727 summary 0 / 0 / 0 Summary of the probe development effort to identify antagonists of the Galanin Receptor 3 (GALR3)
652245 screening 917 / 0 / 639 Fluorescence-based cell-based primary high throughput confirmation assay to identify antagonists of the Galanin Receptor 3 (GalR3)
687013 confirmatory 185 / 0 / 51 Fluorescence-based cell-based primary high throughput dose response assay to identify antagonists of the Galanin Receptor 3 (GalR3).
743095 confirmatory 55 / 0 / 3 Fluorescence-based cell-based late stage dose response assay to identify antagonists of the Galanin Receptor 3 (GalR3)

Gene RIF (10)

PMID Text
24706871 Variants in genes for galanin (GAL) and its receptors (GALR1, GALR2, GALR3), despite their disparate genomic loci, conferred increased risk of depression and anxiety in people who experienced childhood adversity or recent negative life events.
24517231 Data from ligand-receptor interaction studies suggest that human spexin-1 and zebrafish spexin-2 activate galanin receptors GALR2/GALR3 (but not GALR1); thus spexins appear to be natural ligands for human/Xenopus/zebrafish GALR2/GALR3.
22889491 The results suggest that GalR3, a receptor for the neuroendocrine peptide galanin, is a potential marker for relapsing pituitary tumors.
20817064 Mutated human GalR3 receptors are tested with competitive binding analysis in vitro, identifying six different sites in GalR3 that determine binding to galanin.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
17083333 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17083333 GALR3 showed a significant association with alcoholism that was driven by one SNP (rs3,091,367).
11867941 Elevated expression of galanin receptors in childhood neuroblastic tumors.

AA Sequence

MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLFILNLAVADLC      1 - 70
FILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDRYLAVRHPLRSRALRTPRNAR     71 - 140
AAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDARRRALDVATFAAGYLLPVAVVSLAYGRTLRF    141 - 210
LWAAVGPAGAAAAEARRRATGRAGRAMLAVAALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLA    211 - 280
YANSCLNPLVYALASRHFRARFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQG    281 - 350
PEPREGPVHGGEAARGPE                                                        351 - 368
//

Text Mined References (17)

PMID Year Title
25691535 2015 Galanin pathogenic mutations in temporal lobe epilepsy.
24706871 2014 Brain galanin system genes interact with life stresses in depression-related phenotypes.
24517231 2014 Coevolution of the spexin/galanin/kisspeptin family: Spexin activates galanin receptor type II and III.
22889491 2012 Galanin and its three receptors in human pituitary adenoma.
20817064 2010 Determining receptor-ligand interaction of human galanin receptor type 3.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
17083333 2007 Alcoholism is associated with GALR3 but not two other galanin receptor genes.
More...