Property Summary

Ligand Count 19
NCBI Gene PubMed Count 16
PubMed Score 23.94
PubTator Score 17.32

Knowledge Summary

Patent (17,607)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Depressive Disorder, Major 19 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.2e-08
psoriasis 6694 1.4e-03
Multiple Sclerosis 540 2.0e-03

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple Sclerosis 1.100 2.0e-03
osteosarcoma 2.420 3.2e-08
psoriasis 1.200 1.4e-03

Gene RIF (10)

AA Sequence

MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLFILNLAVADLC      1 - 70
FILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDRYLAVRHPLRSRALRTPRNAR     71 - 140
AAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDARRRALDVATFAAGYLLPVAVVSLAYGRTLRF    141 - 210
LWAAVGPAGAAAAEARRRATGRAGRAMLAVAALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLA    211 - 280
YANSCLNPLVYALASRHFRARFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQG    281 - 350
PEPREGPVHGGEAARGPE                                                        351 - 368
//

Text Mined References (17)

PMID Year Title