Property Summary

NCBI Gene PubMed Count 34
Grant Count 25
R01 Count 11
Funding $1,295,141.53
PubMed Score 15.20
PubTator Score 22.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia -2.257 0.003
Chronic Lymphocytic Leukemia -1.837 0.006
Multiple myeloma 1.027 0.008
glioblastoma 1.900 0.000
pancreatic ductal adenocarcinoma liver m... -1.467 0.021
diabetes mellitus -1.100 0.001
ovarian cancer -1.800 0.000
Down syndrome 1.100 0.002

Gene RIF (8)

PMID Text
23531855 SNX2 is highly expressed in 73.3% Graves disease patients and in 93.8% thyroid nodule patients.
23360489 Silencing of SNX2 markedly alters sensitivity to anticancer drugs targeted to c-Met.
20604901 SNX1 and SNX2 interact with the Rac1 and RhoG guanine nucleotide exchange factor Kalirin-7. Overexpression of SNX1 or SNX2 and Kalirin-7 partially redistributes both SNXs to the plasma membrane, and results in RhoG-dependent lamellipodia formation.
17319803 study indicates that hVps34 and its product PI(3)P are involved in endosome to Golgi transport of ricin, and that SNX2 and SNX4 are likely to be effectors in this pathway
17101778 These observations indicate that the mammalian retromer complex assembles by sequential association of SNX1/2 and Vps26-Vps29-Vps35 subcomplexes on endosomal membranes and that SNX1 and SNX2 play interchangeable but essential roles.
16179610 Data suggest that sorting nexin-2 is not essential for the regulation of endosome-to-trans Golgi network retrieval of the cation-independent mannose 6-phosphate receptor.
15690390 The N-terminal domain of Abs interacts with the phox homology (PX) domain of SNX2 suggesting that PX domains may also participate in protein-protein interaction
14978220 Examined the effect of a PX domain-mutated SNX2 that is defective in vesicle localization on EGFR trafficking.

AA Sequence

MAAEREPPPLGDGKPTDFEDLEDGEDLFTSTVSTLESSPSSPEPASLPAEDISANSNGPKPTEVVLDDDR      1 - 70
EDLFAEATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIF     71 - 140
DIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPE    141 - 210
KSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAG    211 - 280
ILRMVNKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAM    281 - 350
LGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDA    351 - 420
QITLLKKREAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVI    421 - 490
IKYLESLVQTQQQLIKYWEAFLPEAKAIA                                             491 - 519
//

Text Mined References (47)

PMID Year Title
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23531855 2014 Sorting Nexin 2 (SNX2): a potential marker of active thyrocytes in normal and hyperfunctioning thyroid disorders.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23360489 2013 Sorting nexin 2-mediated membrane trafficking of c-Met contributes to sensitivity of molecular-targeted drugs.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...