Property Summary

NCBI Gene PubMed Count 35
PubMed Score 17.24
PubTator Score 22.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Chronic Lymphocytic Leukemia -1.837 5.8e-03
diabetes mellitus -1.100 1.1e-03
Down syndrome 1.100 1.6e-03
glioblastoma 1.900 3.9e-04
Multiple myeloma 1.027 7.8e-03
ovarian cancer -1.800 1.2e-05
pancreatic ductal adenocarcinoma liver m... -1.467 2.1e-02
Waldenstrons macroglobulinemia -2.257 3.4e-03

Gene RIF (8)

AA Sequence

MAAEREPPPLGDGKPTDFEDLEDGEDLFTSTVSTLESSPSSPEPASLPAEDISANSNGPKPTEVVLDDDR      1 - 70
EDLFAEATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIF     71 - 140
DIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPE    141 - 210
KSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAG    211 - 280
ILRMVNKAADAVNKMTIKMNESDAWFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAM    281 - 350
LGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDA    351 - 420
QITLLKKREAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVI    421 - 490
IKYLESLVQTQQQLIKYWEAFLPEAKAIA                                             491 - 519
//

Text Mined References (48)

PMID Year Title