Property Summary

NCBI Gene PubMed Count 31
Grant Count 110
R01 Count 64
Funding $15,660,854.11
PubMed Score 5.03
PubTator Score 109.07

Knowledge Summary

Patent (6,041)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -3.600 0.001
ependymoma -2.900 0.022
oligodendroglioma -3.300 0.000
glioblastoma -6.100 0.000
medulloblastoma -4.900 0.000
atypical teratoid / rhabdoid tumor -5.700 0.000
medulloblastoma, large-cell -4.900 0.000
primitive neuroectodermal tumor -4.900 0.000
pediatric high grade glioma -4.900 0.000
pilocytic astrocytoma -5.100 0.000
lung carcinoma 3.100 0.000

Synonym

Accession O60741
Symbols BCNG1
HAC-2
BCNG-1
EIEE24

Gene

Gene RIF (19)

PMID Text
25142030 A new mode of regulating HCN1 trafficking: through the use of a di-arginine ER retention signal that monitors processing of the channel in the early secretory pathway.
24747641 de novo HCN1 point mutations cause a recognizable early-onset epileptic encephalopathy in humans
24403084 acute abrogation of HCN1-FLNa interaction in neurons, with the use of decoy peptides that mimic the FLNa-binding domain of HCN1, abolishes the punctate distribution of HCN1 channels in neuronal cell bodies
23077068 Wild-type presynaptic HCN1 channel function is persistently decreased following seizures.
23033536 Studies suggest that HCN1 channels may be therapeutic targets for treatment of depressive disorders.
22094222 HCN1 channels make an important contribution to the maintenance of spontaneous burst activity in embryonic cortical neuron cultures.
21615589 Genetic analysis in 48 Sudden unexpected death in epilepsy cases identified six novel and three previously reported nonsynonymous (amino acid changing) variants in HCN1 , HCN2, HCN3 and HCN4.
21562186 Hyperpolarization-activated currents are smaller and slower, input resistances are higher, and membrane time constants are longer in HCN1-deficient than in HCN1-expressing neurons of the ventral cochlear nucleus.
21504900 increasing cAMP levels in cells antagonized the up-regulation of HCN1 channels mediated by a TRIP8b construct binding the CNBD exclusively.
20806410 Human HCN1 hyperpolarization activated current (Ih) amplitude is rapidly enhanced after establishment of the whole-cell configuration in HEK293 cells.
More...

AA Sequence

MEGGGKPNSSSNSRDDGNSVFPAKASATGAGPAAAEKRLGTPPGGGGAGAKEHGNSVCFKVDGGGGGGGG      1 - 70
GGGGEEPAGGFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSD     71 - 140
FRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNEDSSEIILDP    141 - 210
KVIKMNYLKSWFVVDFISSIPVDYIFLIVEKGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQ    211 - 280
WEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALF    281 - 350
KAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSF    351 - 420
HKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSK    421 - 490
LRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTASVRADTYCR    491 - 560
LYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQKFQKDLNTGVFNNQENEILKQIVKHDR    561 - 630
EMVQAIAPINYPQMTTLNSTSSTTTPTSRMRTQSPPVYTATSLSHSNLHSPSPSTQTPQPSAILSPCSYT    631 - 700
TAVCSPPVQSPLAARTFHYASPTASQLSLMQQQPQQQVQQSQPPQTQPQQPSPQPQTPGSSTPKNEVHKS    701 - 770
TQALHNTNLTREVRPLSASQPSLPHEVSTLISRPHPTVGESLASIPQPVTAVPGTGLQAGGRSTVPQRVT    771 - 840
LFRQMSSGAIPPNRGVPPAPPPPAAALPRESSSVLNTDPDAEKPRFASNL                        841 - 890
//

Text Mined References (33)

PMID Year Title
25142030 2015 A di-arginine ER retention signal regulates trafficking of HCN1 channels from the early secretory pathway to the plasma membrane.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24747641 2014 De novo mutations in HCN1 cause early infantile epileptic encephalopathy.
24403084 2014 Filamin A promotes dynamin-dependent internalization of hyperpolarization-activated cyclic nucleotide-gated type 1 (HCN1) channels and restricts Ih in hippocampal neurons.
23077068 2012 TRIP8b-independent trafficking and plasticity of adult cortical presynaptic HCN1 channels.
23033536 2012 HCN1 channels: a new therapeutic target for depressive disorders?
22748890 2012 Investigation of hyperpolarization-activated cyclic nucleotide-gated channels in interstitial cells of Cajal of human bladder.
22094222 2012 Hyperpolarization-activated cation current contributes to spontaneous network activity in developing neocortical cultures.
21615589 2011 Genetic analysis of hyperpolarization-activated cyclic nucleotide-gated cation channels in sudden unexpected death in epilepsy cases.
21562186 2011 The magnitudes of hyperpolarization-activated and low-voltage-activated potassium currents co-vary in neurons of the ventral cochlear nucleus.
More...