Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.11
PubTator Score 3.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.215 0.025
Multiple myeloma 1.851 0.000
lung cancer 1.200 0.001
subependymal giant cell astrocytoma -1.334 0.016
ovarian cancer -2.200 0.000

AA Sequence

MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN      1 - 70
GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF                                71 - 113
//

Text Mined References (9)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7904817 1994 Expressed sequence tags identify a human isolog of the suil translation initiation factor.