Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.11
PubTator Score 3.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer 1.200 8.6e-04
Multiple myeloma 1.851 2.3e-04
ovarian cancer -2.200 8.3e-09
subependymal giant cell astrocytoma -1.334 1.6e-02
Waldenstrons macroglobulinemia 1.215 2.5e-02

AA Sequence

MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN      1 - 70
GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF                                71 - 113
//

Text Mined References (9)

PMID Year Title