Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.11
PubTator Score 3.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 8.32672508026562E-9
Multiple myeloma 1328 2.28258999052599E-4
lung cancer 4473 8.58370963303951E-4
subependymal giant cell astrocytoma 2287 0.016288031256399
Waldenstrons macroglobulinemia 765 0.0250400485290188
Disease Target Count Z-score Confidence
Acquired thrombocytopenia 7 5.468 2.7
Uveal melanoma 18 3.012 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.215 0.025
Multiple myeloma 1.851 0.000
lung cancer 1.200 0.001
subependymal giant cell astrocytoma -1.334 0.016
ovarian cancer -2.200 0.000

Synonym

Accession O60739 Q9UQF8 eIF1b
Symbols GC20

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

AA Sequence

MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN      1 - 70
GTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF                                71 - 113
//

Text Mined References (9)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7904817 1994 Expressed sequence tags identify a human isolog of the suil translation initiation factor.