Property Summary

NCBI Gene PubMed Count 116
Grant Count 178
R01 Count 100
Funding $22,681,337.02
PubMed Score 337.28
PubTator Score 228.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.321 0.000

Synonym

Accession O60733 A8K597 B0QYE8 O75645 Q8N452 Q9UG29 Q9UIT0 Q9Y671 CaI-PLA2
Symbols GVI
PLA2
INAD1
NBIA2
iPLA2
NBIA2A
NBIA2B
PARK14
PNPLA9
CaI-PLA2
IPLA2-VIA
iPLA2beta

Gene

PANTHER Protein Class (3)

 IMPC Term (1)

Gene RIF (98)

PMID Text
27196560 PLA2G6 mutations in Indian patients with infantile neuroaxonal dystrophy and atypical late-onset neuroaxonal dystrophy
27030050 This study demonstrated that elevated expression of alphaSyn/PalphaSyn in mitochondria appears to be the early response to PLA2G6-deficiency in neurons.
26755131 Analysis of the cells from idiopathic Parkinson's disease patients reveals a significant deficiency in store-operated PLA2g6-dependent Ca(2+) signalling
26668131 Mutations in PLA2G6 altered Golgi morphology, O-linked glycosylation and sialylation of protein in patients with neurodegeneration
26525102 genetic association study in Quebec City population: Data suggest total plasma n-6 fatty acid phospholipid levels and C-reactive protein are modulated by SNPs in PLA2G4A and PLA2G6 alone or in combination with fish oil dietary supplementation.
26446356 Three catalytically active cPLA2, iPLA2, and sPLA2 are expressed in different areas within the human spermatozoon cell body. Spermatozoa with a significant low motility showed strong differences both in terms of total specific activity and of different intracellular distribution, compared with normal spermatozoa. Phospholipases could be potential biomarkers of asthenozoospermia.
26160611 Results demonstrated no significant impact of PLA2G6 and PLA2G4C gene polymorphisms on attenuated niacin skin flushing in schizophrenia patients.
26001724 our findings demonstrate that loss of normal PLA2G6 gene activity leads to lipid peroxidation, mitochondrial dysfunction and subsequent mitochondrial membrane abnormalities.
25668476 Mutations in PANK2 and CoASY lead, respectively, to PKAN and CoPAN forms of Neurodegeneration with brain iron accumulation . Mutations in PLA2G6 lead to PLAN. Mutations in C19orf12 lead to MPAN
25482049 Stimulation of adrenoreceptors causes increased iPLA2 expression via MAP kinase/ERK 1/2.
More...

AA Sequence

MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFR      1 - 70
LFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRI     71 - 140
ISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAV    141 - 210
AGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIH    211 - 280
SKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHG    281 - 350
NTPLHLAMSKDNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRLVTRKAILTLLRTVGAEYCFPPIHG    351 - 420
VPAEQGSAAPHHPFSLERAQPPPISLNNLELQDLMHISRARKPAFILGSMRDEKRTHDHLLCLDGGGVKG    421 - 490
LIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRMKDEVFRGSRPYESGPL    491 - 560
EEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLV    561 - 630
WRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQ    631 - 700
VPVTCVDVFRPSNPWELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIML    701 - 770
DEVSDTVLVNALWETEVYIYEHREEFQKLIQLLLSP                                      771 - 806
//

Text Mined References (115)

PMID Year Title
27196560 2016 Genetic Analysis of PLA2G6 in 22 Indian Families with Infantile Neuroaxonal Dystrophy, Atypical Late-Onset Neuroaxonal Dystrophy and Dystonia Parkinsonism Complex.
27030050 2016 High expression of ?-synuclein in damaged mitochondria with PLA2G6 dysfunction.
26755131 2016 Impairment of PARK14-dependent Ca(2+) signalling is a novel determinant of Parkinson's disease.
26668131 2016 Disruption of Golgi morphology and altered protein glycosylation in PLA2G6-associated neurodegeneration.
26525102 2015 Modulation of C-reactive protein and plasma omega-6 fatty acid levels by phospholipase A2 gene polymorphisms following a 6-week supplementation with fish oil.
26446356 2015 Asthenozoospermia and membrane remodeling enzymes: a new role for phospholipase A2.
26160611 2015 Polymorphisms in PLA2G6 and PLA2G4C genes for calcium-independent phospholipase A2 do not contribute to attenuated niacin skin flush response in schizophrenia patients.
26001724 2015 Loss of PLA2G6 leads to elevated mitochondrial lipid peroxidation and mitochondrial dysfunction.
25668476 2015 Mitochondria: A crossroads for lipid metabolism defect in neurodegeneration with brain iron accumulation diseases.
25482049 2016 Regulation of Calcium-Independent Phospholipase A2 Expression by Adrenoceptors and Sterol Regulatory Element Binding Protein-Potential Crosstalk Between Sterol and Glycerophospholipid Mediators.
More...