Property Summary

NCBI Gene PubMed Count 27
Grant Count 13
Funding $558,788.33
PubMed Score 85.36
PubTator Score 57.69

Knowledge Summary

Patent

No data available

Gene RIF (21)

PMID Text
26321295 MAGE-C1 and MAGE-C2 expressions were positively associated with high tumor grade and reduced recurrence-free survival in breast cancer.
26161400 expression of CT7 and CT10 throughout the different subtypes of mucosal melanoma and tumor development.
25793710 MAGE C1 expression was observed consistently in the early stem cells (CD34+) and early pro-B to pre-B cells (CD34+/-/CD19+), as well as the proliferating plasma cells.
24896625 MAGEC1/CT7 was expressed in 66% of MM samples.
24842123 Study identified the YKL40 and MAGEC1 genes as temozolomide (TMZ) resistanceassociated biomarkers in the TMZR U87 cell line, which showed an obvious resistance in vivo.
24820892 MAGE-C1 and MAGE-C2 are expressed in myeloma, but the chromosome aberrations do not always correlate with expression
23923079 Positive results of immunohistostaining were obtained in 16 (35.6%), 7 (15.6%) and 36 (80.0%) samples using MAGE-C1, NY-ESO-1 and Sp17 antibodies, respectively
23529156 Expression of the novel CT antigen MAGE-C1/CT7 was most commonly seen with positivity in 24.5 % of primary and 35.1 % of recurrent ovarian carcinomas
23180015 the present study confirmed MAGE-C1/CT7 and MAGE-C2/CT7 expression in monoclonal gammopathies
22110734 the role of MAGE-C1/CT7 in the control of cellular proliferation and cell cycle in myeloma
More...

AA Sequence

MGDKDMPTAGMPSLLQSSSESPQSCPEGEDSQSPLQIPQSSPESDDTLYPLQSPQSRSEGEDSSDPLQRP      1 - 70
PEGKDSQSPLQIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSAL     71 - 140
LSIFQSSPESTQSPFEGFPQSVLQIPVSAASSSTLVSIFQSSPESTQSPFEGFPQSPLQIPVSRSFSSTL    141 - 210
LSIFQSSPERTQSTFEGFAQSPLQIPVSPSSSSTLLSLFQSFSERTQSTFEGFAQSSLQIPVSPSFSSTL    211 - 280
VSLFQSSPERTQSTFEGFPQSPLQIPVSSSSSSTLLSLFQSSPERTHSTFEGFPQSLLQIPMTSSFSSTL    281 - 350
LSIFQSSPESAQSTFEGFPQSPLQIPGSPSFSSTLLSLFQSSPERTHSTFEGFPQSPLQIPMTSSFSSTL    351 - 420
LSILQSSPESAQSAFEGFPQSPLQIPVSSSFSYTLLSLFQSSPERTHSTFEGFPQSPLQIPVSSSSSSST    421 - 490
LLSLFQSSPECTQSTFEGFPQSPLQIPQSPPEGENTHSPLQIVPSLPEWEDSLSPHYFPQSPPQGEDSLS    491 - 560
PHYFPQSPPQGEDSLSPHYFPQSPQGEDSLSPHYFPQSPPQGEDSMSPLYFPQSPLQGEEFQSSLQSPVS    561 - 630
ICSSSTPSSLPQSFPESSQSPPEGPVQSPLHSPQSPPEGMHSQSPLQSPESAPEGEDSLSPLQIPQSPLE    631 - 700
GEDSLSSLHFPQSPPEWEDSLSPLHFPQFPPQGEDFQSSLQSPVSICSSSTSLSLPQSFPESPQSPPEGP    701 - 770
AQSPLQRPVSSFFSYTLASLLQSSHESPQSPPEGPAQSPLQSPVSSFPSSTSSSLSQSSPVSSFPSSTSS    771 - 840
SLSKSSPESPLQSPVISFSSSTSLSPFSEESSSPVDEYTSSSDTLLESDSLTDSESLIESEPLFTYTLDE    841 - 910
KVDELARFLLLKYQVKQPITKAEMLTNVISRYTGYFPVIFRKAREFIEILFGISLREVDPDDSYVFVNTL    911 - 980
DLTSEGCLSDEQGMSQNRLLILILSIIFIKGTYASEEVIWDVLSGIGVRAGREHFAFGEPRELLTKVWVQ    981 - 1050
EHYLEYREVPNSSPPRYEFLWGPRAHSEVIKRKVVEFLAMLKNTVPITFPSSYKDALKDVEERAQAIIDT   1051 - 1120
TDDSTATESASSSVMSPSFSSE                                                   1121 - 1142
//

Text Mined References (30)

PMID Year Title
26321295 2016 The expression of MAGE-C1 and MAGE-C2 in breast cancer and their clinical significance.
26161400 2015 Intratumoral Heterogeneity of MAGE-C1/CT7 and MAGE-C2/CT10 Expression in Mucosal Melanoma.
25793710 2015 The use of MAGE C1 and flow cytometry to determine the malignant cell type in multiple myeloma.
24896625 2014 Is there any relationship between gene expression of tumor antigens and CD4+ T cells in multiple myeloma?
24842123 2014 YKL-40 downregulation is a key factor to overcome temozolomide resistance in a glioblastoma cell line.
24820892 2015 Chromosomal aberrations of cancer-testis antigens in myeloma patients.
23923079 2013 Sperm protein 17, MAGE-C1 and NY-ESO-1 in hepatocellular carcinoma: expression frequency and their correlation with clinical parameters.
23529156 2013 Expression of MAGE-C1/CT7 and selected cancer/testis antigens in ovarian borderline tumours and primary and recurrent ovarian carcinomas.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23180015 2013 MAGE-C1/CT7 and MAGE-C2/CT10 are frequently expressed in multiple myeloma and can be explored in combined immunotherapy for this malignancy.
More...