Property Summary

NCBI Gene PubMed Count 25
PubMed Score 4.05
PubTator Score 22.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (36)

Disease log2 FC p
adult high grade glioma -1.100 3.5e-02
aldosterone-producing adenoma -1.138 3.9e-02
astrocytic glioma -2.600 1.6e-02
atypical teratoid / rhabdoid tumor -1.100 1.3e-03
Breast cancer -1.800 3.0e-10
breast carcinoma -1.100 6.8e-28
chronic lymphosyte leukemia 1.100 7.6e-05
Down syndrome 1.200 5.9e-04
Duchenne muscular dystrophy 1.064 6.0e-06
ductal carcinoma in situ -1.600 2.6e-04
Endometriosis -1.399 1.5e-02
ependymoma -2.800 2.5e-02
gastric cancer 1.300 1.9e-03
glioblastoma -1.100 3.1e-03
group 3 medulloblastoma -1.400 1.2e-02
head and neck cancer and chronic obstruc... -1.100 1.1e-04
hepatocellular carcinoma 1.400 1.9e-04
interstitial cystitis -1.300 9.7e-04
intraductal papillary-mucinous adenoma (... 1.700 1.2e-05
intraductal papillary-mucinous carcinoma... 1.600 2.6e-04
intraductal papillary-mucinous neoplasm ... 1.500 2.9e-03
invasive ductal carcinoma -2.600 1.2e-04
lung cancer 2.100 1.3e-02
malignant mesothelioma -1.500 1.0e-06
medulloblastoma, large-cell -1.900 7.2e-04
oligodendroglioma 1.300 6.2e-03
osteosarcoma -1.587 2.0e-03
ovarian cancer -2.300 1.1e-09
pancreatic cancer 1.500 2.0e-03
pancreatic carcinoma 1.500 2.0e-03
pancreatic ductal adenocarcinoma liver m... -1.349 1.6e-02
Pick disease -1.400 2.2e-04
primitive neuroectodermal tumor -1.700 9.9e-05
progressive supranuclear palsy -1.300 2.3e-02
psoriasis -2.100 1.2e-04
urothelial carcinoma -1.300 3.6e-02

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASN      1 - 70
VHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYM     71 - 140
VIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEK    141 - 210
AENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDH    211 - 280
HDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPG    281 - 350
SVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDD    351 - 420
EINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSI    421 - 490
SRTKTVLR                                                                  491 - 498
//

Text Mined References (28)

PMID Year Title