Property Summary

NCBI Gene PubMed Count 23
PubMed Score 4.05
PubTator Score 22.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 6.78444508979317E-28
Breast cancer 3099 2.56131536010465E-10
atypical teratoid / rhabdoid tumor 4369 6.87896723348472E-10
ovarian cancer 8492 1.21512074041948E-9
glioblastoma 5572 3.32120461413234E-8
osteosarcoma 7933 7.06603467077448E-8
malignant mesothelioma 3163 6.65160969980018E-7
medulloblastoma 1524 2.02752286966292E-6
medulloblastoma, large-cell 6234 2.1629602480949E-6
Duchenne muscular dystrophy 602 5.97617041820878E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 1.22723562876596E-5
chronic lymphosyte leukemia 232 7.58420293563097E-5
primitive neuroectodermal tumor 3031 9.90965760768893E-5
head and neck cancer and chronic obstructive pulmonary disease 237 1.14873693647298E-4
invasive ductal carcinoma 2950 1.17582004421954E-4
hepatocellular carcinoma 550 1.85009087328711E-4
Pick disease 1893 2.19547972689065E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.56867788093291E-4
ductal carcinoma in situ 1745 2.60648670593846E-4
psoriasis 6685 3.34558523171647E-4
pancreatic cancer 2300 5.5270632726929E-4
pancreatic carcinoma 567 5.52706327269293E-4
interstitial cystitis 2299 5.77015789771206E-4
Down syndrome 548 5.86006982126965E-4
gastric cancer 436 9.1432151810139E-4
pediatric high grade glioma 2712 0.00647891168911024
lung cancer 4473 0.0128141424713449
Endometriosis 535 0.0147008748120648
oligodendroglioma 2849 0.0147700572594456
astrocytic glioma 2241 0.0158097467568013
pancreatic ductal adenocarcinoma liver metastasis 1795 0.016099492602547
urothelial carcinoma 318 0.021213885065025
progressive supranuclear palsy 674 0.0233241212009165
ependymoma 2514 0.0253110548311894
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0307048044659648
aldosterone-producing adenoma 664 0.0386428018286212

Expression

Synonym

Accession O60729 A6N5X8 A8MQ20 B1AL31 B1AL32 O43183 O60730 Q5JU08
Symbols CDC14B3
Cdc14B1
Cdc14B2
hCDC14B

Gene

PDB

1OHC   1OHD   1OHE  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG

Gene RIF (12)

PMID Text
26023773 hCdc14B promotes reactivation of rDNA transcription by dephosphorylating TAFI110. SIRT1 becomes transiently enriched in nucleoli at the onset of mitosis. SIRT1 deacetylates TAFI68 destabilizing SL1 binding to the rDNA promoter
24619757 CDC14B expression is downregulated in clear cell renal carinoma, suggesting its role in renal carcinogenesis
22784093 CDC (cell division cycle) 14A/B phosphatases associate with KIBRA, and CDK1-non-phosphorylatable KIBRA has greatly reduced interaction with CDC14B.
21379580 Cdc14B-dependent modulation of Cdc25 phosphatase and Cdk1/cyclin B activity is linked to correct chromosome segregation and bipolar spindle formation, processes that are required for proper progression through mitosis and maintenance of genomic stability.
21301228 studies have revealed a novel interplay between Chk1 kinase and Cdc14B phosphatase involving radiation-induced nucleolar shuttling to facilitate error-free cell cycle progression and prevent genomic instability
20479464 human HCT116, and human telomerase reverse transcription-immortalized retinal pigment epithelial cells deleted for Cdc14B are DNA damage checkpoint proficient and arrest efficiently in G2 in response to irradiation.
18662541 In response to genotoxic stress in G2, the phosphatase Cdc14B translocates from the nucleolus to the nucleoplasm and induces the activation of the ubiquitin ligase APC/C(Cdh1), with the consequent degradation of Plk1, a prominent mitotic kinase.
18458157 Results suggest a potential function for Cdc14B phosphatase in maintaining the fidelity of centrosome duplication cycle.
18418058 Our findings reveal substantial divergence in mitotic regulation between yeast and mammalian cells, as the latter possess efficient mechanisms for completing late M-phase events in the absence of a nucleolar Cdc14-related phosphatase.
15911625 hCdc14A and hCdc14B have functional homology to S. pombe Cdc25 and flp1
More...

AA Sequence

MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASN      1 - 70
VHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYM     71 - 140
VIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEK    141 - 210
AENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDH    211 - 280
HDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPG    281 - 350
SVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDD    351 - 420
EINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSI    421 - 490
SRTKTVLR                                                                  491 - 498
//

Text Mined References (26)

PMID Year Title
26023773 2015 Cooperative Action of Cdk1/cyclin B and SIRT1 Is Required for Mitotic Repression of rRNA Synthesis.
24619757 2014 Loss of CDC14B expression in clear cell renal cell carcinoma: meta-analysis of microarray data sets.
22784093 2012 Phospho-regulation of KIBRA by CDK1 and CDC14 phosphatase controls cell-cycle progression.
21379580 2011 Human Cdc14B promotes progression through mitosis by dephosphorylating Cdc25 and regulating Cdk1/cyclin B activity.
21301228 2011 The DNA damage effector Chk1 kinase regulates Cdc14B nucleolar shuttling during cell cycle progression.
20479464 2010 Vertebrate cells genetically deficient for Cdc14A or Cdc14B retain DNA damage checkpoint proficiency but are impaired in DNA repair.
18662541 2008 The Cdc14B-Cdh1-Plk1 axis controls the G2 DNA-damage-response checkpoint.
18547142 2008 Birth and rapid subcellular adaptation of a hominoid-specific CDC14 protein.
18458157 2008 Cdc14B depletion leads to centriole amplification, and its overexpression prevents unscheduled centriole duplication.
18418058 2008 The nucleolar phosphatase Cdc14B is dispensable for chromosome segregation and mitotic exit in human cells.
More...