Property Summary

NCBI Gene PubMed Count 23
Grant Count 16
R01 Count 9
Funding $1,241,840.83
PubMed Score 4.05
PubTator Score 22.85

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
26023773 hCdc14B promotes reactivation of rDNA transcription by dephosphorylating TAFI110. SIRT1 becomes transiently enriched in nucleoli at the onset of mitosis. SIRT1 deacetylates TAFI68 destabilizing SL1 binding to the rDNA promoter
24619757 CDC14B expression is downregulated in clear cell renal carinoma, suggesting its role in renal carcinogenesis
22784093 CDC (cell division cycle) 14A/B phosphatases associate with KIBRA, and CDK1-non-phosphorylatable KIBRA has greatly reduced interaction with CDC14B.
21379580 Cdc14B-dependent modulation of Cdc25 phosphatase and Cdk1/cyclin B activity is linked to correct chromosome segregation and bipolar spindle formation, processes that are required for proper progression through mitosis and maintenance of genomic stability.
21301228 studies have revealed a novel interplay between Chk1 kinase and Cdc14B phosphatase involving radiation-induced nucleolar shuttling to facilitate error-free cell cycle progression and prevent genomic instability
20479464 human HCT116, and human telomerase reverse transcription-immortalized retinal pigment epithelial cells deleted for Cdc14B are DNA damage checkpoint proficient and arrest efficiently in G2 in response to irradiation.
18662541 In response to genotoxic stress in G2, the phosphatase Cdc14B translocates from the nucleolus to the nucleoplasm and induces the activation of the ubiquitin ligase APC/C(Cdh1), with the consequent degradation of Plk1, a prominent mitotic kinase.
18458157 Results suggest a potential function for Cdc14B phosphatase in maintaining the fidelity of centrosome duplication cycle.
18418058 Our findings reveal substantial divergence in mitotic regulation between yeast and mammalian cells, as the latter possess efficient mechanisms for completing late M-phase events in the absence of a nucleolar Cdc14-related phosphatase.
15911625 hCdc14A and hCdc14B have functional homology to S. pombe Cdc25 and flp1
More...

AA Sequence

MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASN      1 - 70
VHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYM     71 - 140
VIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEK    141 - 210
AENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDH    211 - 280
HDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPG    281 - 350
SVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDD    351 - 420
EINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSI    421 - 490
SRTKTVLR                                                                  491 - 498
//

Text Mined References (26)

PMID Year Title
26023773 2015 Cooperative Action of Cdk1/cyclin B and SIRT1 Is Required for Mitotic Repression of rRNA Synthesis.
24619757 2014 Loss of CDC14B expression in clear cell renal cell carcinoma: meta-analysis of microarray data sets.
22784093 2012 Phospho-regulation of KIBRA by CDK1 and CDC14 phosphatase controls cell-cycle progression.
21379580 2011 Human Cdc14B promotes progression through mitosis by dephosphorylating Cdc25 and regulating Cdk1/cyclin B activity.
21301228 2011 The DNA damage effector Chk1 kinase regulates Cdc14B nucleolar shuttling during cell cycle progression.
20479464 2010 Vertebrate cells genetically deficient for Cdc14A or Cdc14B retain DNA damage checkpoint proficiency but are impaired in DNA repair.
18662541 2008 The Cdc14B-Cdh1-Plk1 axis controls the G2 DNA-damage-response checkpoint.
18547142 2008 Birth and rapid subcellular adaptation of a hominoid-specific CDC14 protein.
18458157 2008 Cdc14B depletion leads to centriole amplification, and its overexpression prevents unscheduled centriole duplication.
18418058 2008 The nucleolar phosphatase Cdc14B is dispensable for chromosome segregation and mitotic exit in human cells.
More...