Property Summary

NCBI Gene PubMed Count 21
Grant Count 77
R01 Count 65
Funding $8,679,242.39
PubMed Score 139.81
PubTator Score 67.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -3.900 0.000
psoriasis -2.400 0.000
osteosarcoma -2.402 0.000
limb girdle muscular dystrophy 2B 1.153 0.000
Becker muscular dystrophy 1.289 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.007
lung cancer 1.200 0.032
lung adenocarcinoma 1.100 0.000
ovarian cancer 1.200 0.001

Synonym

Accession O60725 Q6FHT0
Symbols PCMT
PPMT
PCCMT
HSTE14
MST098
MSTP098

Gene

PANTHER Protein Class (2)

Gene RIF (13)

PMID Text
26706195 simultaneous inhibition of BCR-ABL1 and Icmt may represent a potential therapeutic strategy for CML.
25151967 impact of Icmt on tumorigenic processes
24216479 Silencing ICMT in osteosarcoma cells decreased Notch1 signaling in response to stimulation with cell-surface ligands.
20798596 a role for isoprenylcysteine carboxylmethyltransferase in cell migration and adhesion.
19841875 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19651782 Inhibition of isoprenylcysteine carboxylmethyltransferase (Icmt) decreases activation of RhoA and Rac1, and in the absence of Icmt activity, addition of exogenous RhoA or Rac1 partially rescues directed and random migration, respectively.
19161160 Observational study of gene-disease association. (HuGE Navigator)
19158273 Icmt traverses the Eendoplasmic reticulum membrane eight times, with both N and C termini disposed toward the cytosol and with a helix-turn-helix structure comprising transmembrane (TM) segments 7 and 8.
17347446 ICMT inhibition induces endothelial cell apoptosis through GRP94
14966563 These studies identify isoprenylcysteine carboxyl methyltransferase as a potential target for reducing the growth of K-Ras- and B-Raf-induced malignancies.
More...

AA Sequence

MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYRPPRYQIAIRA      1 - 70
CFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSW     71 - 140
LEFTLENIFWPELKQITWLSVTGLLMVVFGECLRKAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRH    141 - 210
PSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGV    211 - 280
KVDL                                                                      281 - 284
//

Text Mined References (22)

PMID Year Title
26706195 2016 Inhibition of isoprenylcysteine carboxylmethyltransferase augments BCR-ABL1 tyrosine kinase inhibition-induced apoptosis in chronic myeloid leukemia.
25151967 2015 Isoprenylcysteine carboxylmethyltransferase regulates mitochondrial respiration and cancer cell metabolism.
24216479 2013 Isoprenylcysteine carboxylmethyltransferase deficiency exacerbates KRAS-driven pancreatic neoplasia via Notch suppression.
20798596 RHO methylation matters: a role for isoprenylcysteine carboxylmethyltransferase in cell migration and adhesion.
19841875 2010 Polymorphisms of the lamina maturation pathway and their association with the metabolic syndrome: the DESIR prospective study.
19651782 2009 Role of isoprenylcysteine carboxylmethyltransferase-catalyzed methylation in Rho function and migration.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19158273 2009 Topology of mammalian isoprenylcysteine carboxyl methyltransferase determined in live cells with a fluorescent probe.
17347446 2007 Inhibition of ICMT induces endothelial cell apoptosis through GRP94.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...