Property Summary

NCBI Gene PubMed Count 15
PubMed Score 81.48
PubTator Score 36.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.100 2.7e-03
ependymoma 1.300 2.9e-07
glioblastoma 1.100 1.3e-04
group 4 medulloblastoma 1.300 6.0e-04
lung cancer -2.100 4.4e-04
medulloblastoma, large-cell 1.100 6.8e-04
non primary Sjogren syndrome sicca -1.100 2.8e-02
osteosarcoma -2.058 5.6e-06
subependymal giant cell astrocytoma 1.285 2.6e-02

Gene RIF (4)

AA Sequence

MGKLIRMGPQERWLLRTKRLHWSRLLFLLGMLIIGSTYQHLRRPRGLSSLWAAVSSHQPIKLASRDLSSE      1 - 70
EMMMMSSSPSKPSSEMGGKMLVPQASVGSDEATLSMTVENIPSMPKRTAKMIPTTTKNNYSPTAAGTERR     71 - 140
KEDTPTSSRTLTYYTSTSSRQIVKKYTPTPRGEMKSYSPTQVREKVKYTPSPRGRRVGTYVPSTFMTMET    141 - 210
SHAITPRTTVKDSDITATYKILETNSLKRIMEETTPTTLKGMFDSTPTFLTHEVEANVLTSPRSVMEKNN    211 - 280
LFPPRRVESNSSAHPWGLVGKSNPKTPQGTVLLHTPATSEGQVTISTMTGSSPAETKAFTAAWSLRNPSP    281 - 350
RTSVSAIKTAPAIVWRLAKKPSTAPSTSTTPTVRAKLTMQVHHCVVVKPTPAMLTTPSPSLTTALLPEEL    351 - 420
SPSPSVLPPSLPDLHPKGEYPPDLFSVEERRQGWVVLHVFGMMYVFVALAIVCDEYFVPALGVITDKLQI    421 - 490
SEDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSAVFNILFVIGTCSLFSREILNLTWWPLFR    491 - 560
DVSFYILDLIMLILFFLDSLIAWWESLLLLLAYAFYVFTMKWNKHIEVWVKEQLSRRPVAKVMALEDLSK    561 - 630
PGDGAIAVDELQDNKKLKLPSLLTRGSSSTSLHNSTIRSTIYQLMLHSLDPLREVRLAKEKEEESLNQGA    631 - 700
RAQPQAKAESKPEEEEPAKLPAVTVTPAPVPDIKGDQKENPGGQEDVAEAESTGEMPGEEGETAGEGETE    701 - 770
EKSGGETQPEGEGETETQGKGEECEDENEAEGKGDNEGEDEGEIHAEDGEMKGNEGETESQELSAENHGE    771 - 840
AKNDEKGVEDGGGSDGGDSEEEEEEEEEQEEEEEEEEQEEEEEEEEEEEEKGNEEPLSLDWPETRQKQAI    841 - 910
YLFLLPIVFPLWLTVPDVRRQESRKFFVFTFLGSIMWIAMFSYLMVWWAHQVGETIGISEEIMGLTILAA    911 - 980
GTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPVPWLLFSLINGLQPVPVSSNGLFCAIVLLFL    981 - 1050
MLLFVISSIASCKWRMNKILGFTMFLLYFVFLIISVMLEDRIISCPVSV                        1051 - 1099
//

Text Mined References (18)

PMID Year Title