Property Summary

NCBI Gene PubMed Count 196
Grant Count 247
R01 Count 150
Funding $15,432,074.62
PubMed Score 263.78
PubTator Score 360.84

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O60716 A8K939 O15088 O60713 O60714 O60715 O60935 Q6DHZ7 Q6RBX8 Q9UP71 Q9UP72 Q9UP73
Symbols CAS
p120
CTNND
P120CAS
P120CTN
p120(CAS)
p120(CTN)

Gene

PDB

3L6X   3L6Y  

Gene RIF (141)

PMID Text
26992637 expression of catenin-delta1 rescued the inhibitory effect of miR-409-3p on cell migration and invasion
26926447 Immunohistochemical panel of CDX2, p120ctn, c-Myc, and Jagged1 proteins would be to distinguish between low/high grade dysplasia in histologically challenging cases of Barrett's esophagus.
26707622 OGT inhibited the formation of the Ecadherin/catenin complex through reducing the interaction between p120 and Ecadherin.
26477567 Phosphorylation and isoform use in p120-catenin during development and tumorigenesis.
26464646 expression of E-cadherin, and p120 negatively correlated with the tumor differentiation of oral squamous cell carcinoma.
26302406 PLEKHA7 localization to adherens junctions is E-cadherin and p120 dependent.
26097613 p120ctn improves the BBB dysfunction and inflammatory responses induced by LPS through the inhibition of NF-kappaB activation.
26093522 the modulation of HPV-16 E6/E7 expression remarkably influenced cell proliferation, migration, and invasion, as well as the protein levels of E-cadherin and P-cadherin in cervical cell lines.
26067913 Pro-Tumorigenic Phosphorylation of p120 Catenin is associated with Renal and Breast Cancer.
26062780 Survival time of colorectal cancer patients with positive deltacatenin expression was shorter than that of patients with negative deltacatenin expression.
More...

AA Sequence

MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFV      1 - 70
GDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTRRTETT     71 - 140
VKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPP    141 - 210
DGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPY    211 - 280
GLEDDQRSMGYDDLDYGMMSDYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASL    281 - 350
DSLRKGGPPPPNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHP    351 - 420
KKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIV    421 - 490
DHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIF    491 - 560
IVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERYQEAAPNVANNTGPHAASCFGAKKGKDEWFS    561 - 630
RGKKPIEDPANDTVDFPKRTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGR    631 - 700
YIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNF    701 - 770
SEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLE    771 - 840
KEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNER    841 - 910
GDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI                911 - 968
//

Text Mined References (214)

PMID Year Title
26992637 2016 MicroRNA-409-3p inhibits osteosarcoma cell migration and invasion by targeting catenin-?1.
26926447 2016 Increasing diagnostic accuracy to grade dysplasia in Barrett's esophagus using an immunohistochemical panel for CDX2, p120ctn, c-Myc and Jagged1.
26707622 2016 Inhibition of E-cadherin/catenin complex formation by O-linked N-acetylglucosamine transferase is partially independent of its catalytic activity.
26477567 2016 Phosphorylation and isoform use in p120-catenin during development and tumorigenesis.
26464646 2015 Reduced expression of E-cadherin and p120-catenin and elevated expression of PLC-?1 and PIKE are associated with aggressiveness of oral squamous cell carcinoma.
26302406 2015 Distinct E-cadherin-based complexes regulate cell behaviour through miRNA processing or Src and p120 catenin activity.
26097613 2015 P120 catenin attenuates lipopolysaccharide-induced blood-brain barrier dysfunction and inflammatory responses in human brain microvascular endothelial cells.
26093522 2015 HPV-16 E6/E7 promotes cell migration and invasion in cervical cancer via regulating cadherin switch in vitro and in vivo.
26067913 2015 Pro-Tumorigenic Phosphorylation of p120 Catenin in Renal and Breast Cancer.
26062780 2015 Overexpression of ?-catenin is associated with a malignant phenotype and poor prognosis in colorectal cancer.
More...