Property Summary

NCBI Gene PubMed Count 30
Grant Count 23
R01 Count 19
Funding $861,550.28
PubMed Score 158.86
PubTator Score 14.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
cutaneous lupus erythematosus 1.400 0.003
osteosarcoma -1.210 0.017
cystic fibrosis 3.996 0.000
astrocytoma 1.500 0.019
glioblastoma 1.500 0.006
tuberculosis and treatment for 6 months -2.300 0.000
non-small cell lung cancer -1.660 0.000
colon cancer -1.900 0.048
lung cancer -2.800 0.000
interstitial cystitis 1.600 0.004
adult high grade glioma 1.100 0.001
pilocytic astrocytoma 1.200 0.000
primary Sjogren syndrome 1.700 0.000
subependymal giant cell astrocytoma 1.346 0.021
invasive ductal carcinoma 1.200 0.001
lung carcinoma -1.400 0.000
ductal carcinoma in situ 1.300 0.001
ulcerative colitis 1.200 0.006
ovarian cancer -1.300 0.000

Gene RIF (14)

PMID Text
26866573 The full-length leupaxin binds to the Pyk2-focal adhesion targeting domain.
26079947 Authors demonstrate that LPXN directly influences cytoskeletal dynamics via interaction with the actin-binding protein CaD and regulates CaD phosphorylation by recruiting ERK to highly dynamic structures within PCa cells.
25955236 Results show that leupaxin has particular influence on the progression and invasion of breast cancer cells and may therefore represent an interesting candidate protein for diagnosis and therapeutic interventions.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20543562 first evidence of dynamic regulation of leupaxin localization and tyrosine phosphorylation by G-Protein Coupled Receptors
19917054 leupaxin functions as a paxillin counterpart that potently suppresses the tyrosine phosphorylation of paxillin during integrin signaling.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19760607 LPXN, a member of the paxillin superfamily, is fused to RUNX1 in an acute myeloid leukemia patient with a t(11;21)(q12;q22) translocation.
18497331 Leupaxin is enriched in vascular smooth nuscle. It undergoes cytoplasmic/nuclear shuttling & functions as an serum response factor cofactor. It associates with CArG-containing regions. Its ectopic expression induces smooth muscle marker gene expression.
18451096 leupaxin could serve as a potential progression marker for a subset of PCa and may represent a novel coactivator of the androgen receptor
More...

AA Sequence

MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELN      1 - 70
VYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQ     71 - 140
DLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPR    141 - 210
CAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLEN    211 - 280
YLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHP    281 - 350
EHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL                                      351 - 386
//

Text Mined References (37)

PMID Year Title
26866573 2016 Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
26079947 2015 Leupaxin stimulates adhesion and migration of prostate cancer cells through modulation of the phosphorylation status of the actin-binding protein caldesmon.
25955236 2015 Leupaxin is expressed in mammary carcinoma and acts as a transcriptional activator of the estrogen receptor ?.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23349640 2013 Susceptibility loci associated with specific and shared subtypes of lymphoid malignancies.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...