Property Summary

NCBI Gene PubMed Count 31
PubMed Score 162.05
PubTator Score 14.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.100 1.4e-03
astrocytoma 1.500 1.9e-02
Astrocytoma, Pilocytic 1.200 1.0e-07
colon cancer -1.900 4.8e-02
cutaneous lupus erythematosus 1.400 2.5e-03
cystic fibrosis 3.996 1.6e-07
ductal carcinoma in situ 1.300 9.3e-04
glioblastoma 1.500 5.6e-03
interstitial cystitis 1.600 4.2e-03
invasive ductal carcinoma 1.178 2.6e-02
lung cancer -2.800 9.8e-06
lung carcinoma -1.400 1.3e-18
malignant mesothelioma -1.900 1.1e-06
non-small cell lung cancer -1.660 1.9e-12
osteosarcoma -1.210 1.7e-02
ovarian cancer -1.300 1.2e-06
primary Sjogren syndrome 1.700 4.3e-04
subependymal giant cell astrocytoma 1.346 2.1e-02
tuberculosis -1.600 6.9e-06
ulcerative colitis 1.200 5.9e-03

Gene RIF (15)

AA Sequence

MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELN      1 - 70
VYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQ     71 - 140
DLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPR    141 - 210
CAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLEN    211 - 280
YLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHP    281 - 350
EHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL                                      351 - 386
//

Text Mined References (38)

PMID Year Title