Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.78
PubTator Score 3.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.500 3.2e-03
Amyotrophic lateral sclerosis 1.043 3.4e-06
astrocytic glioma -1.300 1.2e-02
Astrocytoma, Pilocytic -1.300 2.1e-04
atypical teratoid / rhabdoid tumor -1.300 1.9e-03
Breast cancer 3.000 2.4e-02
ependymoma -1.700 1.6e-02
glioblastoma -1.300 1.1e-05
group 4 medulloblastoma 1.600 6.2e-03
medulloblastoma, large-cell -1.400 2.0e-02
oligodendroglioma -1.200 1.2e-02
osteosarcoma -4.315 1.7e-09
pituitary cancer 1.200 1.4e-03
Rheumatoid arthritis -1.200 4.5e-02
subependymal giant cell astrocytoma -1.172 1.1e-02

Synonym

Accession O60688 Q65ZA1 Q6GLI6
Symbols FKSG3

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (2)

AA Sequence

MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTG      1 - 70
LHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE                          71 - 119
//

Text Mined References (11)

PMID Year Title