Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.48
PubTator Score 3.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.045
astrocytoma -1.600 0.002
ependymoma -1.900 0.000
oligodendroglioma -1.200 0.012
glioblastoma -3.000 0.000
osteosarcoma -4.315 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma, large-cell -2.200 0.001
Amyotrophic Lateral Sclerosis 1.043 0.000
Breast cancer 3.000 0.024
adult high grade glioma -2.600 0.001
group 4 medulloblastoma 1.600 0.006
pilocytic astrocytoma -1.600 0.002
subependymal giant cell astrocytoma -1.702 0.008
pituitary cancer 1.200 0.001

Gene RIF (2)

PMID Text
20508983 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTG      1 - 70
LHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE                          71 - 119
//

Text Mined References (11)

PMID Year Title
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19893129 2009 Expression of YPEL1 in pancreatic cancer cell lines and tissues.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15556292 2004 Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11473580 2001 Ypel1: a novel nuclear protein that induces an epithelial-like morphology in fibroblasts.
More...