Property Summary

NCBI Gene PubMed Count 25
PubMed Score 717.61
PubTator Score 42.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Perisylvian syndrome 1
Disease Target Count P-value
non-small cell lung cancer 2798 9.6132406271556E-19
lung carcinoma 2844 3.10388178002885E-16
pilocytic astrocytoma 3086 2.3541921017289E-10
malignant mesothelioma 3163 1.0074254385395E-9
adrenocortical carcinoma 1427 2.96764537096321E-8
lung adenocarcinoma 2714 3.68450337923649E-7
posterior fossa group A ependymoma 1511 4.6494777776337E-7
sonic hedgehog group medulloblastoma 1482 6.24571223734903E-7
cystic fibrosis 1670 1.50922089846171E-5
pediatric high grade glioma 2712 2.33089799960338E-5
ovarian cancer 8492 7.42104183317649E-5
glioblastoma 5572 4.69677003094869E-4
atypical teratoid / rhabdoid tumor 4369 5.19809392006847E-4
ulcerative colitis 2087 7.93166264398159E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0100554471220271
subependymal giant cell astrocytoma 2287 0.010738145903808
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0125082497525664
gastric carcinoma 832 0.016226269437539
primary pancreatic ductal adenocarcinoma 1271 0.0200084118400189
pancreatic cancer 2300 0.0234315802099952
esophageal adenocarcinoma 737 0.029297245754901
spina bifida 1064 0.0407586488378292
Disease Target Count Z-score Confidence
Epilepsy 346 4.614 2.3
Intellectual disability 573 3.738 1.9

Expression

Synonym

Accession O60687 B3KQT3 Q8WW85
Symbols BPP
CBPS
PMGX
RESDX
SRPUL

Gene

  Ortholog (13)

Gene RIF (14)

PMID Text
25737434 Increased Sushi repeat-containing protein X-linked 2 is associated with progression of colorectal cancer.
24995671 In rolandic epilepsy patients no major role was found for an association with SRPX2 or ELP4 genes.
24700475 High SRPX2 expression is associated with gastric cancer.
24179158 SRPX2 is an epilepsy- and language-associated gene that is a target of the foxhead box protein P2 (FoxP2) transcription factor.
23115050 Hypomethylation of SRPX2 appeared at the transition from adenoma to carcinoma, and was correlated with adenocarcinoma histology, microsatellite stability, and poor differentiation.
22242148 SRPX2 is a novel chondroitin sulfate proteoglycan that is overexpressed in gastrointestinal cancer cells.
20858596 The FOXP2-SRPX2/uPAR network provides exciting insights into molecular pathways underlying speech-related disorders.
20236627 acts as regulator of ICAM1 and E-selectin during endotoxemia
19667118 These findings suggest that Srpx2 regulates endothelial cell migration and tube formation and provides a new target for modulating angiogenesis.
19065654 the biological functions of SRPX2 include cellular migration and adhesion to cancer cells.
More...

AA Sequence

MASQLTQRGALFLLFFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEAT      1 - 70
CYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVL     71 - 140
LDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLV    141 - 210
KDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSA    211 - 280
GDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAP    281 - 350
DPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVL    351 - 420
IDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE                             421 - 465
//

Text Mined References (25)

PMID Year Title
25737434 2015 Increased Sushi repeat-containing protein X-linked 2 is associated with progression of colorectal cancer.
24995671 2014 Analysis of ELP4, SRPX2, and interacting genes in typical and atypical rolandic epilepsy.
24700475 2014 Impact of overexpression of Sushi repeat-containing protein X-linked 2 gene on outcomes of gastric cancer.
24179158 2013 The human language-associated gene SRPX2 regulates synapse formation and vocalization in mice.
23933820 2013 GRIN2A mutations in acquired epileptic aphasia and related childhood focal epilepsies and encephalopathies with speech and language dysfunction.
23115050 2013 Non-CpG island promoter hypomethylation and miR-149 regulate the expression of SRPX2 in colorectal cancer.
22242148 2012 SRPX2 is a novel chondroitin sulfate proteoglycan that is overexpressed in gastrointestinal cancer.
20858596 2010 Molecular networks implicated in speech-related disorders: FOXP2 regulates the SRPX2/uPAR complex.
20236627 2010 Characterization of SVEP1, KIAA, and SRPX2 in an in vitro cell culture model of endotoxemia.
19667118 2009 Sushi repeat protein X-linked 2, a novel mediator of angiogenesis.
More...