Property Summary

NCBI Gene PubMed Count 25
PubMed Score 775.03
PubTator Score 42.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Epilepsy 792 4.57 2.3
Intellectual disability 1016 3.69 1.8

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.719 3.0e-08
adult high grade glioma 2.000 4.1e-04
Astrocytoma, Pilocytic 3.100 2.8e-10
atypical teratoid / rhabdoid tumor 1.300 5.2e-04
cystic fibrosis 1.421 1.5e-05
ependymoma 1.300 4.0e-04
esophageal adenocarcinoma -1.400 2.9e-02
gastric carcinoma 2.100 1.6e-02
glioblastoma 2.300 3.6e-05
intraductal papillary-mucinous adenoma (... -1.500 1.0e-02
intraductal papillary-mucinous carcinoma... -1.600 1.3e-02
lung adenocarcinoma 2.000 3.7e-07
lung carcinoma -1.800 3.1e-16
malignant mesothelioma -5.200 1.0e-09
medulloblastoma 1.300 9.1e-04
non-small cell lung cancer 2.032 9.6e-19
ovarian cancer 2.800 7.4e-05
pancreatic cancer 1.300 1.4e-03
primary pancreatic ductal adenocarcinoma 1.395 2.0e-02
spina bifida -1.752 4.1e-02
subependymal giant cell astrocytoma 3.210 1.1e-02
ulcerative colitis 1.200 7.9e-04

Gene RIF (14)

AA Sequence

MASQLTQRGALFLLFFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEAT      1 - 70
CYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVL     71 - 140
LDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLV    141 - 210
KDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSA    211 - 280
GDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAP    281 - 350
DPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVL    351 - 420
IDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE                             421 - 465
//

Text Mined References (25)

PMID Year Title