Property Summary

NCBI Gene PubMed Count 60
Grant Count 4
Funding $402,768.34
PubMed Score 6.54
PubTator Score 3.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.200 0.001
osteosarcoma -2.246 0.000
medulloblastoma, large-cell -1.100 0.000
adult high grade glioma -1.500 0.000
group 4 medulloblastoma -1.300 0.001
ovarian cancer 2.200 0.000

Synonym

Accession O60684 B2RDC7 D3DPP5 Q5VVU3
Symbols IPOA7
KPNA7

Gene

PANTHER Protein Class (1)

PDB

4UAD  

Gene RIF (62)

PMID Text
26052702 BIG3 may block the KPNAs (KPNA1, KPNA5, and KPNA6) binding region(s) of PHB2.
25272585 Bel1 fragment with residues 215-223, which bears the NLS, interacts with KPNA1, KPNA6, and KPNA7.
22928108 HIV-1 Rev interacting protein, karyopherin alpha 6 (importin alpha 7) (KPNA6), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22928108 HIV-1 Rev interacting protein, karyopherin alpha 6 (importin alpha 7) (KPNA6), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22275867 Importin alpha1 and alpha7 are positive regulators of human-like polymerase activity and pathogenicity beyond their role in nuclear transport.
22174317 HIV-1 Rev interacting protein, karyopherin alpha 6 (importin alpha 7) (KPNA6), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21383067 Overexpression of KPNA6 facilitates KEAP1 nuclear import and attenuates NRF2 signaling, whereas knockdown of KPNA6 slows down KEAP1 nuclear import and enhances the NRF2-mediated adaptive response induced by oxidative stress.
16298512 Importin alpha5 and alpha7 bind to Stat3 upon cytokine stimulation.
15037073 HIV-1 Rev interacting protein, karyopherin alpha 6 (importin alpha 7) (KPNA6), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
12414950 HIV-1 Rev interacting protein, karyopherin alpha 6 (importin alpha 7) (KPNA6), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
More...

AA Sequence

METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDS      1 - 70
YVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPRVVDRFVEFLKRNENCT     71 - 140
LQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSSVCRDYVLNCSI    141 - 210
LNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLS    211 - 280
DGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKE    281 - 350
SIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSL    351 - 420
GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEI    421 - 490
YQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL                            491 - 536
//

Text Mined References (68)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26052702 2015 BIG3 Inhibits the Estrogen-Dependent Nuclear Translocation of PHB2 via Multiple Karyopherin-Alpha Proteins in Breast Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25272585 2014 [Identification of prototype foamy virus Bel1 nuclear localization signal and its corresponding importins].
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22275867 2012 Human-like PB2 627K influenza virus polymerase activity is regulated by importin-?1 and -?7.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21383067 2011 KPNA6 (Importin {alpha}7)-mediated nuclear import of Keap1 represses the Nrf2-dependent antioxidant response.
More...