Property Summary

NCBI Gene PubMed Count 69
PubMed Score 7.13
PubTator Score 3.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.500 2.3e-05
group 4 medulloblastoma -1.300 5.5e-04
medulloblastoma, large-cell -1.100 1.4e-04
osteosarcoma -2.246 1.7e-09
ovarian cancer 1.100 2.0e-03
psoriasis -1.200 5.6e-04

Gene RIF (46)

AA Sequence

METMASPGKDNYRMKSYKNNALNPEEMRRRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDS      1 - 70
YVSSTTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTPRVVDRFVEFLKRNENCT     71 - 140
LQFEAAWALTNIASGTSQQTKIVIEAGAVPIFIELLNSDFEDVQEQAVWALGNIAGDSSVCRDYVLNCSI    141 - 210
LNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLS    211 - 280
DGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKE    281 - 350
SIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSL    351 - 420
GCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEI    421 - 490
YQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL                            491 - 536
//

Text Mined References (77)

PMID Year Title