Property Summary

NCBI Gene PubMed Count 13
Grant Count 47
R01 Count 33
Funding $5,796,856.16
PubMed Score 144.87
PubTator Score 141.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 0.004
cystic fibrosis -1.713 0.000
atypical teratoid / rhabdoid tumor -1.100 0.001
tuberculosis -2.000 0.000

Gene RIF (4)

PMID Text
25070843 results demonstrate that ABF-1 facilitates formation of memory B cells but prevents plasma cell differentiation.
20634891 Observational study of gene-disease association. (HuGE Navigator)
18368067 ABF-1 is frequently silenced by promoter methylation in follicular lymphoma, diffuse large B-cell lymphoma and Burkitt's lymphoma.
15052269 role in repressing lymphotoxin alpha

AA Sequence

MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCALGTAGSAEGC      1 - 70
KRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPD     71 - 140
TKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRPDSDTKEVSAANRLCGTTA        141 - 206
//

Text Mined References (13)

PMID Year Title
25070843 2014 Transcription factor ABF-1 suppresses plasma cell differentiation but facilitates memory B cell formation.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
18368067 2008 ABF-1 is frequently silenced by promoter methylation in follicular lymphoma, diffuse large B-cell lymphoma and Burkitt's lymphoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15052269 2004 Allele-specific repression of lymphotoxin-alpha by activated B cell factor-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11560778 2001 Characterization of a basic helix-loop-helix protein, ABF-1: nuclear localization, transcriptional properties, and interaction with Id-2.
10198176 1999 Assignment of the human helix-loop-helix transcription factor gene musculin/activated B-cell factor-1 (MSC) to chromosome 8q21 and its mouse homologue (Msc) to the proximal region of chromosome 1.
More...