Property Summary

NCBI Gene PubMed Count 14
PubMed Score 292.01
PubTator Score 52.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Infertility, Male 46 0.0 0.0
Disease Target Count
Male infertility 206
Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0
Disease Target Count Z-score Confidence
Contagious pustular dermatitis 11 3.066 1.5

Gene RIF (3)

AA Sequence

MPRCRWLSLILLTIPLALVARKDPKKNETGVLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVK      1 - 70
TLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCE     71 - 140
DA                                                                        141 - 142
//

Text Mined References (15)

PMID Year Title