Property Summary

NCBI Gene PubMed Count 14
Grant Count 124
R01 Count 87
Funding $18,368,168.92
PubMed Score 263.98
PubTator Score 52.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession O60676 Q2M2X6
Symbols CRES
CTES5

Gene

Gene RIF (3)

PMID Text
20565543 We show with phylogenetic relations that the CTES genes are clustered into three original groups, a testatin, a Cres, and a CstL1 group
19204726 Observational study of gene-disease association. (HuGE Navigator)
12193387 studies show that cystatin-related epididymal spermatogenic protein is present in the sperm equatorial segment and becomes accessible to the extracellular environment during fertilization

AA Sequence

MPRCRWLSLILLTIPLALVARKDPKKNETGVLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVK      1 - 70
TLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCE     71 - 140
DA                                                                        141 - 142
//

Text Mined References (15)

PMID Year Title
20565543 Evolution and human tissue expression of the Cres/Testatin subgroup genes, a reproductive tissue specific subgroup of the type 2 cystatins.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12193387 2002 Identification and characterization of cystatin-related epididymal spermatogenic protein in human spermatozoa: localization in the equatorial segment.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10229662 1999 Structure, alternative splicing and chromosomal localization of the cystatin-related epididymal spermatogenic gene.
9007972 1997 Friends and relations of the cystatin superfamily--new members and their evolution.
More...