Property Summary

NCBI Gene PubMed Count 23
PubMed Score 33.47
PubTator Score 16.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.409 3.7e-02
astrocytic glioma -1.500 3.9e-03
gastric carcinoma 1.200 2.2e-02
group 3 medulloblastoma -1.800 5.7e-05
intraductal papillary-mucinous neoplasm ... 1.200 3.9e-03
medulloblastoma, large-cell -2.100 1.4e-05
oligodendroglioma -1.400 1.2e-02
osteosarcoma -1.398 1.5e-02
ovarian cancer -2.500 5.2e-11
pancreatic ductal adenocarcinoma liver m... 1.347 1.7e-02

Gene RIF (6)

AA Sequence

MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGYAASCRI      1 - 70
KRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFARTVARGPVAPSKVATTSVITIV     71 - 140
KSTELSSTSVPFSAAS                                                          141 - 156
//

Text Mined References (30)

PMID Year Title