Property Summary

NCBI Gene PubMed Count 20
Grant Count 17
R01 Count 11
Funding $699,996.19
PubMed Score 32.53
PubTator Score 16.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (5)

PMID Text
26214410 Results suggested that Wnt1-induced MAFK expression promoted cell proliferation in MG63 cells, and that the role of MAFK in osteosarcoma might be closely linked to the Wnt signaling pathway.
24247732 MafK mediated p65 acetylation by CBP upon LPS stimulation, thereby facilitating recruitment of p65 to NF-kappaB promoters such as IL-8 and TNFalpha.
24232097 Results suggest that JDP2 is an integral component of the Nrf2-MafK complex and that it modulates antioxidant and detoxification programs by acting via the ARE.
23737527 Data indicate that transcription factors MafK and Bach1 regulate expression of heme oxygenase-1 (HO-1).
22855609 These findings demonstrate that a combination of p45NF-E2, Maf G, and Maf K is a key determinant of both megakaryopoiesis and thrombopoiesis.

AA Sequence

MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGYAASCRI      1 - 70
KRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFARTVARGPVAPSKVATTSVITIV     71 - 140
KSTELSSTSVPFSAAS                                                          141 - 156
//

Text Mined References (26)

PMID Year Title
26214410 2015 Wnt1-induced MAFK expression promotes osteosarcoma cell proliferation.
24247732 2013 MafK positively regulates NF-?B activity by enhancing CBP-mediated p65 acetylation.
24232097 2013 Jun dimerization protein 2 is a critical component of the Nrf2/MafK complex regulating the response to ROS homeostasis.
23737527 2013 Transforming growth factor-? induces transcription factors MafK and Bach1 to suppress expression of the heme oxygenase-1 gene.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22855609 2012 Induction of functional platelets from mouse and human fibroblasts by p45NF-E2/Maf.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...