Property Summary

NCBI Gene PubMed Count 1,196
Grant Count 796
R01 Count 477
Funding $70,080,208.26
PubMed Score 3102.93
PubTator Score 2952.78

Knowledge Summary

Patent (135,858)

Expression

  Differential Expression (10)

Disease log2 FC p
ulcerative colitis 1.500 0.000
systemic lupus erythematosus 1.100 0.001
urothelial carcinoma -1.200 0.003
malignant mesothelioma -1.300 0.000
osteosarcoma -1.560 0.000
cystic fibrosis -1.189 0.000
medulloblastoma, large-cell -1.100 0.001
tuberculosis 2.200 0.000
primary Sjogren syndrome 1.100 0.004
ovarian cancer -1.100 0.000

Synonym

Accession O60674 O14636 O75297
Symbols JTK10
THCYT3

Gene

PDB

2B7A   2W1I   2XA4   3E62   3E63   3E64   3FUP   3IO7   3IOK   3JY9   3KCK   3KRR   3LPB   3Q32   3RVG   3TJC   3TJD   3UGC   3ZMM   4AQC   4BBE   4BBF   4C61   4C62   4D0W   4D0X   4D1S   4E4M   4E6D   4E6Q   4F08   4F09   4FVP   4FVQ   4FVR   4GFM   4GMY   4HGE   4IVA   4JI9   4JIA   4P7E   4YTC   4YTF   4YTH   4YTI   4Z32   4ZIM   5AEP   5CF4   5CF5   5CF6   5CF8   5I4N   5L3A  

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
1446 screening 2401 / 0 / 215716 Primary cell-based high throughput assay for inhibitors of the Janus kinase 2 mutant JAK2V617F
1521 screening 381 / 0 / 195 Confirmation cell-based high throughput screening assay for inhibitors of the Janus kinase 2 mutant JAK2V617F
1699 confirmatory 91 / 0 / 17 Luminescent counterscreen for inhibitors of the Janus kinase 2 mutant JAK2V617F: dose response cell-based high throughput screening assay for inhibitors of parental Ba/F3 cell viability.
1797 summary 0 / 0 / 0 Summary of probe development efforts to identify inhibitors of the Janus kinase 2 mutant JAK2V617F
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2165 screening 129 / 0 / 59 Late stage results from the probe development effort to identify inhibitors of the Janus kinase 2 mutant JAK2V617F.
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (1119)

PMID Text
26917989 And the clinical characteristics of ET patients, such as WBC counts, hemoglobin level, splenomegaly and thrombosis, were influenced by JAK2V617F mutation burden
26852656 The polymorphisms in TNF-238 GA and TNF-308 GA were associated to myeloproliferative neoplasms development in this population, triggered by JAK2 V617F mutation.
26762740 Genetic amplification of the JAK2 gene was correlated with Non-Small Cell Lung Cancer.
26707639 Our study suggests that pyrvinium is a useful addition to T-cell lymphoma treatment, and emphasizes the potential therapeutic value of the differences in the mitochondrial characteristics between malignant and normal T-cells in blood cancer.
26682870 HSP90 inhibitor ganetespib inhibits pancreatic cancer cell proliferation via JAK2/STAT3 pathway.
26676749 a novel role for JAK2/STAT1 in EGFR-mediated immune evasion, and therapies targeting this signaling axis may be beneficial to block PD-L1 upregulation found in a large subset of head and neck cancer tumors.
26648570 our data suggest that SIRT6 suppresses glioma cell growth via induction of apoptosis, inhibition of oxidative stress and inhibition of the activation of the JAK2/STAT3 signaling pathway.
26646156 The transduction of hematopoietic stem cells with mJAK2 increased their proliferation capacity in EPO-free culture conditions.
26635038 STAT1 activation in association with JAK2 exon 12 mutations.
26625816 JAK2 V617F mutated patients expressed an aggressive disease phenotype.
More...

AA Sequence

MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSGEYVAEEICIA      1 - 70
ASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYFPRWYCSGSNRAYRHGISRGA     71 - 140
EAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLGMAVLDMMRIAKENDQTPLAIYNSISYKTFL    141 - 210
PKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPS    211 - 280
GEEIFATIIITGNGGIQWSRGKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGK    281 - 350
NLEIELSSLREALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT    351 - 420
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDN    421 - 490
IIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKIRNEDLIFNESLGQGTFTKIF    491 - 560
KGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVK    561 - 630
FGSLDTYLKKNKNCINILWKLEVAKQLAWAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDP    631 - 700
GISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRH    701 - 770
QLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD    771 - 840
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNI    841 - 910
VKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATR    911 - 980
NILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTY    981 - 1050
IEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLA   1051 - 1120
LRVDQIRDNMAG                                                             1121 - 1132
//

Text Mined References (1205)

PMID Year Title
26917989 2016 Impact of JAK2V617F Mutation Burden on Disease Phenotype in Chinese Patients with JAK2V617F-positive Polycythemia Vera (PV) and Essential thrombocythemia (ET).
26852656 2016 Association of TNF polymorphisms with JAK2 (V617F) myeloproliferative neoplasms in Brazilian patients.
26762740 2016 PD-L1 Is Upregulated by Simultaneous Amplification of the PD-L1 and JAK2 Genes in Non-Small Cell Lung Cancer.
26707639 2016 Pyrvinium selectively induces apoptosis of lymphoma cells through impairing mitochondrial functions and JAK2/STAT5.
26682870 2016 Targeting the Janus-activated kinase-2-STAT3 signalling pathway in pancreatic cancer using the HSP90 inhibitor ganetespib.
26676749 2016 Identification of the Cell-Intrinsic and -Extrinsic Pathways Downstream of EGFR and IFN? That Induce PD-L1 Expression in Head and Neck Cancer.
26648570 2016 SIRT6 suppresses glioma cell growth via induction of apoptosis, inhibition of oxidative stress and suppression of JAK2/STAT3 signaling pathway activation.
26646156 2016 Application of mutant JAK2V617F for in vitro generation of red blood cells.
26635038 2016 STAT1 activation in association with JAK2 exon 12 mutations.
26625816 2015 JAK-2 V617F Mutational Analysis in Primary Idiopathic Myelofibrosis: Experience from Southern Pakistan.
More...