Property Summary

NCBI Gene PubMed Count 52
Grant Count 101
R01 Count 72
Funding $8,765,848.07
PubMed Score 154.82
PubTator Score 64.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis 1.800 0.001
ependymoma 1.400 0.034
osteosarcoma 1.405 0.000
glioblastoma 1.100 0.001
group 3 medulloblastoma 1.800 0.005
primitive neuroectodermal tumor 1.600 0.000
juvenile dermatomyositis 1.345 0.000
acute quadriplegic myopathy 1.213 0.000
pilocytic astrocytoma 1.200 0.001
lung adenocarcinoma -1.100 0.000
invasive ductal carcinoma -1.300 0.001
ovarian cancer -1.500 0.000
dermatomyositis 1.400 0.001

Synonym

Accession O60673 O43214 Q5TC33
Symbols POLZ
REV3

Gene

PDB

3ABD   3ABE   3VU7   4EXT   4GK0   4GK5  

Gene RIF (34)

PMID Text
26752104 REV3L plays an important role in esophageal squamous cell carcinoma (ESCC) progression and chemoresistance, and is a potential diagnostic marker and therapeutic target for ESCC
26462070 REV3 functions in mammalian mitochondria and that mitochondrial REV3 is associated with the tumorigenic potential of cells.
26165320 Taken together, we demonstrated that inhibition of REV3L sensitized lung cancer H1299 cells to cisplatin treatment
26068067 finding that PLXND1 and REV3L mutations are responsible for a proportion of MBS patients suggests that de novo mutations in other genes might account for other MBS patients
25781640 data suggest that REV3L plays an important role in regulating cervical cancer cellular response to cisplatin
25113059 Rev3, the catalytic subunit of polymerase zeta (Pol zeta), is involved in DNA replication under conditions of replication stress caused by deoxyribonucleotide shortage and/or imbalance in human lung adenocarcinoma cells.
25014791 Single nucleotide polymorphisms in RBPJ, IL1R1, REV3L, TRAF3IP2, IRF1 and ICOS showed association with rheumatoid arthritis in black South Africans.
24956248 Our results suggest for the first time that REV1 and REV3L SNPs might serve as potential predictive markers of outcome of cisplatin-based chemotherapy
24449906 Human Pol eta inserts a nucleotide opposite the lesion, followed by Pol zeta extending the DNA primer; thus, the two complement each other to fully bypass the cisplatin cross-link.
23456618 DNA polymerase zeta is a predictor of poor prognosis for cervical cancer patients who are resistant to chemoradiation.
More...

AA Sequence

MFSVRIVTADYYMASPLQGLDTCQSPLTQAPVKKVPVVRVFGATPAGQKTCLHLHGIFPYLYVPYDGYGQ      1 - 70
QPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICELL     71 - 140
QSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAVKFRKARRKSNTLHATGSCKNHLSGNSLADT    141 - 210
LFRWEQDEIPSSLILEGVEPQSTCELEVDAVAADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNETSQ    211 - 280
MSQPESQDHRFVPATESEKKFQKRLQEILKQNDFSVTLSGSVDYSDGSQEFSAELTLHSEVLSPEMLQCT    281 - 350
PANMVEVHKDKESSKGHTRHKVEEALINEEAILNLMENSQTFQPLTQRLSESPVFMDSSPDEALVHLLAG    351 - 420
LESDGYRGERNRMPSPCRSFGNNKYPQNSDDEENEPQIEKEEMELSLVMSQRWDSNIEEHCAKKRSLCRN    421 - 490
THRSSTEDDDSSSGEEMEWSDNSLLLASLSIPQLDGTADENSDNPLNNENSRTHSSVIATSKLSVKPSIF    491 - 560
HKDAATLEPSSSAKITFQCKHTSALSSHVLNKEDLIEDLSQTNKNTEKGLDNSVTSFTNESTYSMKYPGS    561 - 630
LSSTVHSENSHKENSKKEILPVSSCESSIFDYEEDIPSVTRQVPSRKYTNIRKIEKDSPFIHMHRHPNEN    631 - 700
TLGKNSFNFSDLNHSKNKVSSEGNEKGNSTALSSLFPSSFTENCELLSCSGENRTMVHSLNSTADESGLN    701 - 770
KLKIRYEEFQEHKTEKPSLSQQAAHYMFFPSVVLSNCLTRPQKLSPVTYKLQPGNKPSRLKLNKRKLAGH    771 - 840
QETSTKSSETGSTKDNFIQNNPCNSNPEKDNALASDLTKTTRGAFENKTPTDGFIDCHFGDGTLETEQSF    841 - 910
GLYGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGESLDGTLKSRKRRKMSKKLPPVIIKYII    911 - 980
INRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPLKDFWPKVPDSPATKYPIYPLTPKKSHRRKS    981 - 1050
KHKSAKKKTGKQQRTNNENIKRTLSFRKKRSHAILSPPSPSYNAETEDCDLNYSDVMSKLGFLSERSTSP   1051 - 1120
INSSPPRCWSPTDPRAEEIMAAAEKEAMLFKGPNVYKKTVNSRIGKTSRARAQIKKSKAKLANPSIVTKK   1121 - 1190
RNKRNQTNKLVDDGKKKPRAKQKTNEKGTSRKHTTLKDEKIKSQSGAEVKFVLKHQNVSEFASSSGGSQL   1191 - 1260
LFKQKDMPLMGSAVDHPLSASLPTGINAQQKLSGCFSSFLESKKSVDLQTFPSSRDDLHPSVVCNSIGPG   1261 - 1330
VSKINVQRPHNQSAMFTLKESTLIQKNIFDLSNHLSQVAQNTQISSGMSSKIEDNANNIQRNYLSSIGKL   1331 - 1400
SEYRNSLESKLDQAYTPNFLHCKDSQQQIVCIAEQSKHSETCSPGNTASEESQMPNNCFVTSLRSPIKQI   1401 - 1470
AWEQKQRGFILDMSNFKPERVKPRSLSEAISQTKALSQCKNRNVSTPSAFGEGQSGLAVLKELLQKRQQK   1471 - 1540
AQNANTTQDPLSNKHQPNKNISGSLEHNKANKRTRSVTSPRKPRTPRSTKQKEKIPKLLKVDSLNLQNSS   1541 - 1610
QLDNSVSDDSPIFFSDPGFESCYSLEDSLSPEHNYNFDINTIGQTGFCSFYSGSQFVPADQNLPQKFLSD   1611 - 1680
AVQDLFPGQAIEKNEFLSHDNQKCDEDKHHTTDSASWIRSGTLSPEIFEKSTIDSNENRRHNQWKNSFHP   1681 - 1750
LTTRSNSIMDSFCVQQAEDCLSEKSRLNRSSVSKEVFLSLPQPNNSDWIQGHTRKEMGQSLDSANTSFTA   1751 - 1820
ILSSPDGELVDVACEDLELYVSRNNDMLTPTPDSSPRSTSSPSQSKNGSFTPRTANILKPLMSPPSREEI   1821 - 1890
MATLLDHDLSETIYQEPFCSNPSDVPEKPREIGGRLLMVETRLANDLAEFEGDFSLEGLRLWKTAFSAMT   1891 - 1960
QNPRPGSPLRSGQGVVNKGSSNSPKMVEDKKIVIMPCKCAPSRQLVQVWLQAKEEYERSKKLPKTKPTGV   1961 - 2030
VKSAENFSSSVNPDDKPVVPPKMDVSPCILPTTAHTKEDVDNSQIALQAPTTGCSQTASESQMLPPVASA   2031 - 2100
SDPEKDEDDDDNYYISYSSPDSPVIPPWQQPISPDSKALNGDDRPSSPVEELPSLAFENFLKPIKDGIQK   2101 - 2170
SPCSEPQEPLVISPINTRARTGKCESLCFHSTPIIQRKLLERLPEAPGLSPLSTEPKTQKLSNKKGSNTD   2171 - 2240
TLRRVLLTQAKNQFAAVNTPQKETSQIDGPSLNNTYGFKVSIQNLQEAKALHEIQNLTLISVELHARTRR   2241 - 2310
DLEPDPEFDPICALFYCISSDTPLPDTEKTELTGVIVIDKDKTVFSQDIRYQTPLLIRSGITGLEVTYAA   2311 - 2380
DEKALFHEIANIIKRYDPDILLGYEIQMHSWGYLLQRAAALSIDLCRMISRVPDDKIENRFAAERDEYGS   2381 - 2450
YTMSEINIVGRITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFTFRVLSDWFDNKTDLYRWKMVDHY   2451 - 2520
VSRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVTPSVQQRSQMR   2521 - 2590
APQCVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLGKYDEFKFGCTSLRVPPDLL   2591 - 2660
YQVRHDITVSPNGVAFVKPSVRKGVLPRMLEEILKTRFMVKQSMKAYKQDRALSRMLDARQLGLKLIANV   2661 - 2730
TFGYTSANFSGRMPCIEVGDSIVHKARETLERAIKLVNDTKKWGARVVYGDTDSMFVLLKGATKEQSFKI   2731 - 2800
GQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKRYVGYMYETLDQKDPVFDAKGIETVRRDSCPAVSKIL   2801 - 2870
ERSLKLLFETRDISLIKQYVQRQCMKLLEGKASIQDFIFAKEYRGSFSYKPGACVPALELTRKMLTYDRR   2871 - 2940
SEPQVGERVPYVIIYGTPGVPLIQLVRRPVEVLQDPTLRLNATYYITKQILPPLARIFSLIGIDVFSWYH   2941 - 3010
ELPRIHKATSSSRSEPEGRKGTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQQE   3011 - 3080
QLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF                       3081 - 3130
//

Text Mined References (54)

PMID Year Title
26752104 2016 REV3L, the catalytic subunit of DNA polymerase ?, is involved in the progression and chemoresistance of esophageal squamous cell carcinoma.
26462070 2015 Human REV3 DNA Polymerase Zeta Localizes to Mitochondria and Protects the Mitochondrial Genome.
26165320 2015 REV3L modulates cisplatin sensitivity of non-small cell lung cancer H1299 cells.
26068067 2015 De novo mutations in PLXND1 and REV3L cause Möbius syndrome.
25781640 2015 REV3L, a promising target in regulating the chemosensitivity of cervical cancer cells.
25113059 2014 Whole genome RNAi screens reveal a critical role of REV3 in coping with replication stress.
25014791 2014 Immunochip identifies novel, and replicates known, genetic risk loci for rheumatoid arthritis in black South Africans.
24956248 2014 Polymorphisms in translesion polymerase genes influence treatment outcome in malignant mesothelioma.
24449906 2014 Human Pol ? purified with accessory subunits is active in translesion DNA synthesis and complements Pol ? in cisplatin bypass.
23456618 2013 DNA polymerase ? as a potential biomarker of chemoradiation resistance and poor prognosis for cervical cancer.
More...