Property Summary

NCBI Gene PubMed Count 55
Grant Count 120
R01 Count 92
Funding $5,124,161.05
PubMed Score 98.10
PubTator Score 105.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 0.030
psoriasis 1.600 0.000
osteosarcoma 2.326 0.000
tuberculosis and treatment for 6 months -1.400 0.000
invasive ductal carcinoma 1.300 0.005
ovarian cancer 1.100 0.001
pituitary cancer 1.100 0.000

Synonym

Accession O60671 O75572 O95304 Q1W161 Q5KSM0 Q5KSM1 Q9UEP1 hRAD1
Symbols REC1
HRAD1

Gene

PDB

3A1J   3G65   3GGR  

Gene RIF (23)

PMID Text
26088138 Intramolecular binding of the rad9 C-terminus in the checkpoint clamp Rad9-Hus1-Rad1 is closely linked with its DNA binding.
22586102 Data show models for the ternary PCNA/FEN1/DNA and Rad9-Rad1-Hus1 (9-1-1 complex)/FEN1/DNA assemblies.
21978893 The RAD1 is loaded to damaged sites where it serves as a platform for the selective recruitment of checkpoint and repair proteins.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20545769 CK2 plays a crucial role in the ATR-dependent checkpoint pathway through its ability to phosphorylate Ser-341 and Ser-387 of the Rad9 subunit of the Rad9-Hus1-Rad1 complex
20188637 9-1-1 complex is a component of the mismatch repair involved in MNNG-induced damage response.
19615952 Rad9-Rad1-Hus1 complex enhances in vitro activity of 8-oxoguanine DNA glycosylase.
19535328 The interdomain connecting loops (IDC loop) of hRad9, hHus1, and hRad1 are largely divergent and unique structural features of the 9-1-1 complex that are proposed to contribute to DNA damage recognition.
19523882 The DNA binding domain (DBD) within the hLigI catalytic fragment interacts with both PCNA and the heterotrimeric cell-cycle checkpoint clamp, hRad9-hRad1-hHus1 (9-1-1).
19074885 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
17855402 Human thymine DNA glycosylase activity is significantly stimulated by hHus1, hRad1, hRad9 separately, and by the 9-1-1 complex.
17583730 Jab1 physically associates with the 9-1-1 complex; this association is mediated through direct interaction between Jab1 and Rad1, one of the subunits of the 9-1-1 complex
17493829 we report successful tri-cistronic cloning, overexpression and purification of a three-protein complex of Rad9, Rad1 and Hus1 using a single hexa-histidine tag.
17395641 Human NEIL1 DNA glycosylase activity is significantly stimulated by hRad1 and by the Rad9/Rad1/Hus1 heterotrimer.
16814252 These data provide in vivo evidence that the human 9-1-1 complex participates in DNA repair in addition to its previously described role in DNA damage sensing.
16731526 human DNA ligase I is stimulated by the Rad9-rad1-Hus1 checkpoint complex
16216273 PCNA and the Rad9/Rad1/Hus1 complex can independently bind and activate Fen1; acetylation of Fen1 by p300-HAT abolished the stimulatory effect of the complex but not that of PCNA, suggesting a possible mechanism of regulation of this repair pathway
15871698 The long-patch base excision machinery is an important target of the Rad9-Rad1-Hus1 complex, thus enhancing the quality control of DNA.
15556996 complex with rad9 and hus1 is a damage-specific activator of flap endonuclease 1
15314187 The human Rad9/Rad1/Hus1 complex interacts with and stimulates DNA polymerase beta activity.
15122316 RAD1 is a potential intrinsic chaperone in the stabilization of HUS1 for the heterotrimeric (RAD9-RAD1-HUS1) checkpoint complex formation.
12228248 Rad9, Hus1, and Rad1 heterotrimeric complex chromatin binding is a proximal event in the checkpoint signaling cascade

AA Sequence

MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIF      1 - 70
QEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLMLFLEEGGVVTVCKINTQEPE     71 - 140
ETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLM    141 - 210
EAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES    211 - 280
ES                                                                        281 - 282
//

Text Mined References (57)

PMID Year Title
26088138 2015 Intramolecular Binding of the Rad9 C Terminus in the Checkpoint Clamp Rad9-Hus1-Rad1 Is Closely Linked with Its DNA Binding.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22586102 2012 Repair complexes of FEN1 endonuclease, DNA, and Rad9-Hus1-Rad1 are distinguished from their PCNA counterparts by functionally important stability.
21978893 2011 9-1-1: PCNA's specialized cousin.
21659603 2011 A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20545769 2010 Casein kinase 2-dependent phosphorylation of human Rad9 mediates the interaction between human Rad9-Hus1-Rad1 complex and TopBP1.
20188637 2010 Interaction between human mismatch repair recognition proteins and checkpoint sensor Rad9-Rad1-Hus1.
19615952 2009 Repair activities of human 8-oxoguanine DNA glycosylase are stimulated by the interaction with human checkpoint sensor Rad9-Rad1-Hus1 complex.
19535328 2009 Structure and functional implications of the human rad9-hus1-rad1 cell cycle checkpoint complex.
19523882 2009 The DNA binding domain of human DNA ligase I interacts with both nicked DNA and the DNA sliding clamps, PCNA and hRad9-hRad1-hHus1.
19464297 2009 Crystal structure of the human rad9-hus1-rad1 clamp.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17855402 2007 The human checkpoint sensor Rad9-Rad1-Hus1 interacts with and stimulates DNA repair enzyme TDG glycosylase.
17583730 2007 Jab1 mediates protein degradation of the Rad9-Rad1-Hus1 checkpoint complex.
17493829 2007 Tri-cistronic cloning, overexpression and purification of human Rad9, Rad1, Hus1 protein complex.
17395641 2007 The human checkpoint sensor Rad9-Rad1-Hus1 interacts with and stimulates NEIL1 glycosylase.
16814252 2006 The Rad9 protein enhances survival and promotes DNA repair following exposure to ionizing radiation.
16731526 2006 Mechanism of stimulation of human DNA ligase I by the Rad9-rad1-Hus1 checkpoint complex.
16216273 2005 The two DNA clamps Rad9/Rad1/Hus1 complex and proliferating cell nuclear antigen differentially regulate flap endonuclease 1 activity.
15897895 2005 Interaction and colocalization of Rad9/Rad1/Hus1 checkpoint complex with replication protein A in human cells.
15871698 2005 The human checkpoint sensor and alternative DNA clamp Rad9-Rad1-Hus1 modulates the activity of DNA ligase I, a component of the long-patch base excision repair machinery.
15556996 2004 The human Rad9-Rad1-Hus1 checkpoint complex stimulates flap endonuclease 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15314187 2004 The human Rad9/Rad1/Hus1 damage sensor clamp interacts with DNA polymerase beta and increases its DNA substrate utilisation efficiency: implications for DNA repair.
15122316 2004 Human hRad1 but not hRad9 protects hHus1 from ubiquitin-proteasomal degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14611806 2003 Identification and characterization of RAD9B, a paralog of the RAD9 checkpoint gene.
14500360 2003 Expression of mammalian paralogues of HRAD9 and Mrad9 checkpoint control genes in normal and cancerous testicular tissue.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12578958 2003 Loading of the human 9-1-1 checkpoint complex onto DNA by the checkpoint clamp loader hRad17-replication factor C complex in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228248 2002 Genotoxin-induced Rad9-Hus1-Rad1 (9-1-1) chromatin association is an early checkpoint signaling event.
11994305 2002 A role of the C-terminal region of human Rad9 (hRad9) in nuclear transport of the hRad9 checkpoint complex.
11944979 2002 Identification and characterization of a paralog of human cell cycle checkpoint gene HUS1.
11907025 2002 Structures of the human Rad17-replication factor C and checkpoint Rad 9-1-1 complexes visualized by glycerol spray/low voltage microscopy.
11799063 2002 Regulation of ATR substrate selection by Rad17-dependent loading of Rad9 complexes onto chromatin.
11573955 2001 The J domain of Tpr2 regulates its interaction with the proapoptotic and cell-cycle checkpoint protein, Rad9.
11418864 2001 ATR/ATM-mediated phosphorylation of human Rad17 is required for genotoxic stress responses.
11340080 2001 Reconstitution and molecular analysis of the hRad9-hHus1-hRad1 (9-1-1) DNA damage responsive checkpoint complex.
10884395 2000 The human checkpoint protein hRad17 interacts with the PCNA-like proteins hRad1, hHus1, and hRad9.
10852904 2000 Retention of the human Rad9 checkpoint complex in extraction-resistant nuclear complexes after DNA damage.
10846170 2000 HDAC1, a histone deacetylase, forms a complex with Hus1 and Rad9, two G2/M checkpoint Rad proteins.
10777662 2000 Physical interactions among human checkpoint control proteins HUS1p, RAD1p, and RAD9p, and implications for the regulation of cell cycle progression.
10359610 1999 The human G2 checkpoint control protein hRAD9 is a nuclear phosphoprotein that forms complexes with hRAD1 and hHUS1.
9878245 1998 cDNA cloning and gene mapping of human homologs for Schizosaccharomyces pombe rad17, rad1, and hus1 and cloning of homologs from mouse, Caenorhabditis elegans, and Drosophila melanogaster.
9872989 1999 Human homologs of Schizosaccharomyces pombe rad1, hus1, and rad9 form a DNA damage-responsive protein complex.
9828139 1998 RAD1, a human structural homolog of the Schizosaccharomyces pombe RAD1 cell cycle checkpoint gene.
9828137 1998 A human and mouse homolog of the Schizosaccharomyces pombe rad1+ cell cycle checkpoint control gene.
9716408 1998 Human and mouse homologs of Schizosaccharomyces pombe rad1(+) and Saccharomyces cerevisiae RAD17: linkage to checkpoint control and mammalian meiosis.
9705507 1998 HRAD1 and MRAD1 encode mammalian homologues of the fission yeast rad1(+) cell cycle checkpoint control gene.
9660799 1998 A human homologue of the Schizosaccharomyces pombe rad1+ checkpoint gene encodes an exonuclease.
8361362 1993 Yeast DNA recombination and repair proteins Rad1 and Rad10 constitute a complex in vivo mediated by localized hydrophobic domains.