Property Summary

NCBI Gene PubMed Count 55
Grant Count 120
R01 Count 92
Funding $5,124,161.05
PubMed Score 98.10
PubTator Score 105.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 0.030
psoriasis 1.600 0.000
osteosarcoma 2.326 0.000
tuberculosis and treatment for 6 months -1.400 0.000
invasive ductal carcinoma 1.300 0.005
ovarian cancer 1.100 0.001
pituitary cancer 1.100 0.000

Synonym

Accession O60671 O75572 O95304 Q1W161 Q5KSM0 Q5KSM1 Q9UEP1 hRAD1
Symbols REC1
HRAD1

Gene

PDB

3A1J   3G65   3GGR  

Gene RIF (23)

PMID Text
26088138 Intramolecular binding of the rad9 C-terminus in the checkpoint clamp Rad9-Hus1-Rad1 is closely linked with its DNA binding.
22586102 Data show models for the ternary PCNA/FEN1/DNA and Rad9-Rad1-Hus1 (9-1-1 complex)/FEN1/DNA assemblies.
21978893 The RAD1 is loaded to damaged sites where it serves as a platform for the selective recruitment of checkpoint and repair proteins.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20545769 CK2 plays a crucial role in the ATR-dependent checkpoint pathway through its ability to phosphorylate Ser-341 and Ser-387 of the Rad9 subunit of the Rad9-Hus1-Rad1 complex
20188637 9-1-1 complex is a component of the mismatch repair involved in MNNG-induced damage response.
19615952 Rad9-Rad1-Hus1 complex enhances in vitro activity of 8-oxoguanine DNA glycosylase.
19535328 The interdomain connecting loops (IDC loop) of hRad9, hHus1, and hRad1 are largely divergent and unique structural features of the 9-1-1 complex that are proposed to contribute to DNA damage recognition.
19523882 The DNA binding domain (DBD) within the hLigI catalytic fragment interacts with both PCNA and the heterotrimeric cell-cycle checkpoint clamp, hRad9-hRad1-hHus1 (9-1-1).
19074885 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIF      1 - 70
QEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLMLFLEEGGVVTVCKINTQEPE     71 - 140
ETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLM    141 - 210
EAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES    211 - 280
ES                                                                        281 - 282
//

Text Mined References (57)

PMID Year Title
26088138 2015 Intramolecular Binding of the Rad9 C Terminus in the Checkpoint Clamp Rad9-Hus1-Rad1 Is Closely Linked with Its DNA Binding.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22586102 2012 Repair complexes of FEN1 endonuclease, DNA, and Rad9-Hus1-Rad1 are distinguished from their PCNA counterparts by functionally important stability.
21978893 2011 9-1-1: PCNA's specialized cousin.
21659603 2011 A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20545769 2010 Casein kinase 2-dependent phosphorylation of human Rad9 mediates the interaction between human Rad9-Hus1-Rad1 complex and TopBP1.
20188637 2010 Interaction between human mismatch repair recognition proteins and checkpoint sensor Rad9-Rad1-Hus1.
More...