Property Summary

NCBI Gene PubMed Count 30
PubMed Score 87.44
PubTator Score 45.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Obesity 616
Disease Target Count P-value
breast carcinoma 1614 1.54912825312645E-17
posterior fossa group B ependymoma 1530 5.04960668299718E-12
atypical teratoid / rhabdoid tumor 4369 1.92291486422262E-11
ovarian cancer 8492 7.82891748094472E-8
psoriasis 6685 2.31184136013795E-6
glioblastoma 5572 7.93549565529859E-6
sonic hedgehog group medulloblastoma 1482 1.64181335973462E-5
tuberculosis 1563 9.16150725893773E-5
medulloblastoma, large-cell 6234 9.96399789136974E-5
ductal carcinoma in situ 1745 2.51168284007381E-4
osteosarcoma 7933 3.41425089074649E-4
invasive ductal carcinoma 2950 4.64206727403234E-4
primitive neuroectodermal tumor 3031 0.00151441199173721
nasopharyngeal carcinoma 1056 0.00217132879944616
Rheumatoid Arthritis 1171 0.00454521739411801
Pick disease 1893 0.00539226860488189
adult high grade glioma 2148 0.00745208965732603
colon cancer 1475 0.00961956251232726
Atopic dermatitis 944 0.00963334114871093
lung cancer 4473 0.0102704267185642
active Crohn's disease 918 0.013384229767275
astrocytic glioma 2241 0.0175250421562343
active ulcerative colitis 477 0.0270380597267666
urothelial carcinoma 318 0.0329047105113509
spina bifida 1064 0.0390283710096485
gastric carcinoma 832 0.0392155993521516
fibroadenoma 557 0.0398500586341043
Disease Target Count Z-score Confidence
Heart disease 279 0.0 1.0
Disease Target Count Z-score Confidence
Hypoglycemia 81 3.365 1.7

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 2.500 0.005
urothelial carcinoma -1.800 0.033
astrocytic glioma -1.900 0.018
posterior fossa group B ependymoma -3.200 0.000
glioblastoma -2.400 0.000
osteosarcoma 2.477 0.000
sonic hedgehog group medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -2.300 0.002
Atopic dermatitis -1.500 0.010
tuberculosis 1.100 0.000
lung cancer -3.000 0.010
colon cancer -1.400 0.010
active Crohn's disease 1.033 0.013
active ulcerative colitis 2.171 0.027
breast carcinoma -1.900 0.000
fibroadenoma -1.500 0.040
adult high grade glioma -1.600 0.007
nasopharyngeal carcinoma -1.100 0.002
psoriasis -1.100 0.000
spina bifida -1.516 0.039
Pick disease 1.900 0.005
gastric carcinoma -2.700 0.039
ductal carcinoma in situ -3.300 0.000
invasive ductal carcinoma -4.400 0.000
ovarian cancer -2.100 0.000

Synonym

Accession O60669 Q8NEM3 Q9UPB3 MCT 2
Symbols MCT2

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (20)

PMID Text
26035357 SLC16A7 (MCT2) epigenetic regulation results in protein over-expression, affecting signalling and cellular phenotypes in prostate cancer
25639644 Data suggest that monocarboxylate transporter 2 (MCT2) at peroxisomes is related to an increase in beta-oxidation levels which may be crucial for malignant transformation.
25578492 Our findings suggest that SNPs in MCT1 and MCT2 genes may affect clinical outcomes and can be used to predict the response to adjuvant chemotherapy in NSCLC patients who received surgical treatment once validated in future study.
25492048 SNPs in MCT1 and MCT2 genes may affect clinical outcomes and can be used to predict the response to adjuvant chemotherapy in CRC patients who received surgical treatment.
25243493 This study identified that CGPs was found to significantly correlate with the differential expression and methylation of genes encoding solute carrier family 16, member 7.
24799634 MCT2-3' UTR SNP (+2626 G > A) had a strong association with oligoasthenoteratozoospermia.
23192371 this study provided evidence for the presence of MCT2 in prostate cancer, selectively labeling malignant glands.
22964484 The monocarboxylate transporter 2 (MCT2) protein was tumor-selectively expressed in human colorectal malignancies and knockdown of MCT2 induces mitochondrial dysfunction, cell-cycle arrest, and senescence.
22535546 Light microscopic immunohistochemistry revealed significantly less perivascular MCT2 immunoreactivity in the hippocampal formation in medial temporal lobe epilepsy than in non-MTLE patients
21787388 Data show that a significant increase of MCT2 and MCT4 expression in the cytoplasm of tumour cells and a significant decrease in both MCT1 and CD147 expression in prostate tumour cells was observed when compared to normal tissue.
More...

AA Sequence

MPPMPSAPPVHPPPDGGWGWIVVGAAFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAWISSIMLAVMY      1 - 70
AGGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFITGLGLAFNLQPALTIIGKYFY     71 - 140
RKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLILGSLLLNACVAGSLMRPLGPNQTTSKSKNK    141 - 210
TGKTEDDSSPKKIKTKKSTWEKVNKYLDFSLFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEY    211 - 280
SAAFLLSVMAFVDMFARPSVGLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLG    281 - 350
FGSVSSVLFETLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMYMSCGAIVVAASVW    351 - 420
LLIGNAINYRLLAKERKEENARQKTRESEPLSKSKHSEDVNVKVSNAQSVTSERETNI                421 - 478
//

Text Mined References (33)

PMID Year Title
26035357 2015 Epigenetic and oncogenic regulation of SLC16A7 (MCT2) results in protein over-expression, impacting on signalling and cellular phenotypes in prostate cancer.
25639644 2015 Localization of MCT2 at peroxisomes is associated with malignant transformation in prostate cancer.
25578492 2015 Genetic variations in monocarboxylate transporter genes as predictors of clinical outcomes in non-small cell lung cancer.
25492048 2015 Polymorphisms of monocarboxylate transporter genes are associated with clinical outcomes in patients with colorectal cancer.
25243493 2014 Correlation between DNA methylation and gene expression in the brains of patients with bipolar disorder and schizophrenia.
24799634 The genetic variation in monocarboxylic acid transporter 2 (MCT2) has functional and clinical relevance with male infertility.
23192371 2013 Monocarboxylate transporter 2 (MCT2) as putative biomarker in prostate cancer.
22964484 2012 Inhibition of monocarboxylate transporter 2 induces senescence-associated mitochondrial dysfunction and suppresses progression of colorectal malignancies in vivo.
22700320 2012 Alterations of monocarboxylate transporter densities during hypoxia in brain and breast tumour cells.
22535546 2012 Redistribution of monocarboxylate transporter 2 on the surface of astrocytes in the human epileptogenic hippocampus.
More...