Property Summary

NCBI Gene PubMed Count 30
Grant Count 28
R01 Count 20
Funding $5,679,769.16
PubMed Score 87.44
PubTator Score 45.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 2.500 0.005
urothelial carcinoma -1.800 0.033
astrocytic glioma -1.900 0.018
posterior fossa group B ependymoma -3.200 0.000
glioblastoma -2.400 0.000
osteosarcoma 2.477 0.000
sonic hedgehog group medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -2.300 0.002
Atopic dermatitis -1.500 0.010
tuberculosis 1.100 0.000
lung cancer -3.000 0.010
colon cancer -1.400 0.010
active Crohn's disease 1.033 0.013
active ulcerative colitis 2.171 0.027
breast carcinoma -1.900 0.000
fibroadenoma -1.500 0.040
adult high grade glioma -1.600 0.007
nasopharyngeal carcinoma -1.100 0.002
psoriasis -1.100 0.000
spina bifida -1.516 0.039
Pick disease 1.900 0.005
gastric carcinoma -2.700 0.039
ductal carcinoma in situ -3.300 0.000
invasive ductal carcinoma -4.400 0.000
ovarian cancer -2.100 0.000

Gene RIF (20)

PMID Text
26035357 SLC16A7 (MCT2) epigenetic regulation results in protein over-expression, affecting signalling and cellular phenotypes in prostate cancer
25639644 Data suggest that monocarboxylate transporter 2 (MCT2) at peroxisomes is related to an increase in beta-oxidation levels which may be crucial for malignant transformation.
25578492 Our findings suggest that SNPs in MCT1 and MCT2 genes may affect clinical outcomes and can be used to predict the response to adjuvant chemotherapy in NSCLC patients who received surgical treatment once validated in future study.
25492048 SNPs in MCT1 and MCT2 genes may affect clinical outcomes and can be used to predict the response to adjuvant chemotherapy in CRC patients who received surgical treatment.
25243493 This study identified that CGPs was found to significantly correlate with the differential expression and methylation of genes encoding solute carrier family 16, member 7.
24799634 MCT2-3' UTR SNP (+2626 G > A) had a strong association with oligoasthenoteratozoospermia.
23192371 this study provided evidence for the presence of MCT2 in prostate cancer, selectively labeling malignant glands.
22964484 The monocarboxylate transporter 2 (MCT2) protein was tumor-selectively expressed in human colorectal malignancies and knockdown of MCT2 induces mitochondrial dysfunction, cell-cycle arrest, and senescence.
22535546 Light microscopic immunohistochemistry revealed significantly less perivascular MCT2 immunoreactivity in the hippocampal formation in medial temporal lobe epilepsy than in non-MTLE patients
21787388 Data show that a significant increase of MCT2 and MCT4 expression in the cytoplasm of tumour cells and a significant decrease in both MCT1 and CD147 expression in prostate tumour cells was observed when compared to normal tissue.
More...

AA Sequence

MPPMPSAPPVHPPPDGGWGWIVVGAAFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAWISSIMLAVMY      1 - 70
AGGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFITGLGLAFNLQPALTIIGKYFY     71 - 140
RKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLILGSLLLNACVAGSLMRPLGPNQTTSKSKNK    141 - 210
TGKTEDDSSPKKIKTKKSTWEKVNKYLDFSLFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEY    211 - 280
SAAFLLSVMAFVDMFARPSVGLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLG    281 - 350
FGSVSSVLFETLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMYMSCGAIVVAASVW    351 - 420
LLIGNAINYRLLAKERKEENARQKTRESEPLSKSKHSEDVNVKVSNAQSVTSERETNI                421 - 478
//

Text Mined References (33)

PMID Year Title
26035357 2015 Epigenetic and oncogenic regulation of SLC16A7 (MCT2) results in protein over-expression, impacting on signalling and cellular phenotypes in prostate cancer.
25639644 2015 Localization of MCT2 at peroxisomes is associated with malignant transformation in prostate cancer.
25578492 2015 Genetic variations in monocarboxylate transporter genes as predictors of clinical outcomes in non-small cell lung cancer.
25492048 2015 Polymorphisms of monocarboxylate transporter genes are associated with clinical outcomes in patients with colorectal cancer.
25243493 2014 Correlation between DNA methylation and gene expression in the brains of patients with bipolar disorder and schizophrenia.
24799634 The genetic variation in monocarboxylic acid transporter 2 (MCT2) has functional and clinical relevance with male infertility.
23192371 2013 Monocarboxylate transporter 2 (MCT2) as putative biomarker in prostate cancer.
22964484 2012 Inhibition of monocarboxylate transporter 2 induces senescence-associated mitochondrial dysfunction and suppresses progression of colorectal malignancies in vivo.
22700320 2012 Alterations of monocarboxylate transporter densities during hypoxia in brain and breast tumour cells.
22535546 2012 Redistribution of monocarboxylate transporter 2 on the surface of astrocytes in the human epileptogenic hippocampus.
More...