Property Summary

NCBI Gene PubMed Count 54
PubMed Score 73.49
PubTator Score 90.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.00891270585286E-10
lung adenocarcinoma 2714 4.20860018509603E-9
atypical teratoid / rhabdoid tumor 4369 5.86305566654383E-7
pediatric high grade glioma 2712 9.18716573290742E-7
glioblastoma 5572 1.8127289855315E-6
pilocytic astrocytoma 3086 3.71065506279662E-6
psoriasis 6685 1.02821142404868E-5
osteosarcoma 7933 1.36960600462172E-5
acute quadriplegic myopathy 1157 7.42187036082349E-5
ovarian cancer 8492 0.00117076552786365
diabetes mellitus 1663 0.00293119127059624
astrocytoma 1493 0.00331410859679575
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00524555495121835
adrenocortical carcinoma 1427 0.00989987203740219
gastric carcinoma 832 0.0269562934308743
esophageal adenocarcinoma 737 0.0463922812028085
Disease Target Count Z-score Confidence
Sebaceous adenoma 11 3.187 1.6

Expression

  Differential Expression (16)

Synonym

Accession O60664 A8K4Y9 K7EQF4 Q53G77 Q9BS03 Q9UBD7 Q9UP92
Symbols PP17
TIP47
M6PRBP1

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (39)

PMID Text
26742848 Conserved amphipathic helices mediate lipid droplet targeting of PLIN1, PLIN2, and PLIN3.
26171795 Differential expression of PLIN3 and brefeldin A sensitivity may explain differential lipid oxidation efficiency in skeletal muscle among healthy lean, sedentary, and T2 diabetic males.
26170028 Results indicate that microRNAs miR-148a and miR-30a, regulate Tail interacting protein of 47 kDa (TIP47) expression and lipid droplets (LD) in hepatitis C virus infected cells.
25595097 Postprandial triglyceride rich lipoproteins may be involved in atherosclerotic plaque formation through the regulation of perilipin-2 and perilipin-3 proteins in macrophages.
25342854 Following exercise training, perilipin 3 protein expression was increased in the adipose tissue of women with polycystic ovary syndrome.
25039349 PLIN3 functions are intertwined with the lipogenic pathways implicated in sebaceous lipogenesis, such as desaturation and triglyceride synthesis.
24632837 Skeletal muscle perilipin 3 and coatomer proteins are increased following exercise and are associated with fat oxidation.
24480419 Rab9-complexed TIP47 plays an essential role for the proper release of hepatitis C viral particles.
23936516 PLIN3 is associated with the synthesis and secretion of PGE2
23705972 TIP47 overexpression or RNA interference (RNAi)-mediated depletion have no significant effect on HIV-1 Env incorporation, virus release, or particle infectivity in HeLa cells and in Jurkat cells
More...

AA Sequence

MSADGAEADGSTQVTVEEPVQQPSVVDRVASMPLISSTCDMVSAAYASTKESYPHIKTVCDAAEKGVRTL      1 - 70
TAAAVSGAQPILSKLEPQIASASEYAHRGLDKLEENLPILQQPTEKVLADTKELVSSKVSGAQEMVSSAK     71 - 140
DTVATQLSEAVDATRGAVQSGVDKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAE    141 - 210
LARIATSLDGFDVASVQQQRQEQSYFVRLGSLSERLRQHAYEHSLGKLRATKQRAQEALLQLSQVLSLME    211 - 280
TVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQG    281 - 350
LPTNVKDQVQQARRQVEDLQATFSSIHSFQDLSSSILAQSRERVASAREALDHMVEYVAQNTPVTWLVGP    351 - 420
FAPGITEKAPEEKK                                                            421 - 434
//

Text Mined References (66)

PMID Year Title
26742848 2016 Conserved Amphipathic Helices Mediate Lipid Droplet Targeting of Perilipins 1-3.
26171795 2015 Perilipin 3 Differentially Regulates Skeletal Muscle Lipid Oxidation in Active, Sedentary, and Type 2 Diabetic Males.
26170028 2015 Epigenetic harnessing of HCV via modulating the lipid droplet-protein, TIP47, in HCV cell models.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25595097 2015 Postprandial triglyceride-rich lipoproteins regulate perilipin-2 and perilipin-3 lipid-droplet-associated proteins in macrophages.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25342854 2015 Potential effects of aerobic exercise on the expression of perilipin 3 in the adipose tissue of women with polycystic ovary syndrome: a pilot study.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25039349 2014 Perilipin 3 modulates specific lipogenic pathways in SZ95 sebocytes.
More...