Property Summary

NCBI Gene PubMed Count 54
PubMed Score 77.91
PubTator Score 90.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.148 7.4e-05
adrenocortical carcinoma 1.081 9.9e-03
astrocytoma 1.400 3.3e-03
Astrocytoma, Pilocytic 1.600 3.9e-06
atypical teratoid / rhabdoid tumor 1.700 5.9e-07
diabetes mellitus -1.500 2.9e-03
ependymoma 1.500 2.0e-13
esophageal adenocarcinoma -1.100 4.6e-02
gastric carcinoma 1.100 2.7e-02
glioblastoma 1.200 2.0e-04
lung adenocarcinoma 1.200 4.2e-09
osteosarcoma 1.826 1.4e-05
ovarian cancer 1.300 1.2e-03
pancreatic ductal adenocarcinoma liver m... 1.015 5.2e-03
pediatric high grade glioma 1.800 9.2e-07
psoriasis 2.300 1.0e-05

Protein-protein Interaction (2)

Gene RIF (39)

AA Sequence

MSADGAEADGSTQVTVEEPVQQPSVVDRVASMPLISSTCDMVSAAYASTKESYPHIKTVCDAAEKGVRTL      1 - 70
TAAAVSGAQPILSKLEPQIASASEYAHRGLDKLEENLPILQQPTEKVLADTKELVSSKVSGAQEMVSSAK     71 - 140
DTVATQLSEAVDATRGAVQSGVDKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAE    141 - 210
LARIATSLDGFDVASVQQQRQEQSYFVRLGSLSERLRQHAYEHSLGKLRATKQRAQEALLQLSQVLSLME    211 - 280
TVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQG    281 - 350
LPTNVKDQVQQARRQVEDLQATFSSIHSFQDLSSSILAQSRERVASAREALDHMVEYVAQNTPVTWLVGP    351 - 420
FAPGITEKAPEEKK                                                            421 - 434
//

Text Mined References (67)

PMID Year Title