Property Summary

NCBI Gene PubMed Count 60
PubMed Score 180.33
PubTator Score 109.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
psoriasis 6694 5.4e-36
lung carcinoma 2843 1.3e-18
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 2.7

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.100 1.3e-18
psoriasis -1.300 5.4e-36

 OMIM Phenotype (1)

Gene RIF (44)

AA Sequence

MDIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMR      1 - 70
VNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALECVYHLGC     71 - 140
FCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSG    141 - 210
DDGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARR    211 - 280
HQQQQEQQNSQRLGQEVLSSRMEGMMASYTPLAPPQQQIVAMEQSPYGSSDPFQQGLTPPQMPGDHMNPY    281 - 350
GNDSIFHDIDSDTSLTSLSDCFLGSSDVGSLQARVGNPIDRLYSMQSSYFAS                      351 - 402
//

Text Mined References (63)

PMID Year Title