Property Summary

NCBI Gene PubMed Count 23
Grant Count 19
R01 Count 14
Funding $1,872,102.24
PubMed Score 20.79
PubTator Score 18.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.300 0.041
osteosarcoma 1.722 0.000
colon cancer -1.300 0.021
group 4 medulloblastoma -2.000 0.000
posterior fossa group A ependymoma 1.200 0.000
Pick disease -2.000 0.000
progressive supranuclear palsy -2.200 0.011
ovarian cancer -1.800 0.000
Down syndrome 1.200 0.008

Gene RIF (17)

PMID Text
25295610 PDE8A supports HIV-1 replication in macrophages
25295610 HIV-1 replication is enhanced by PDE8A
25295610 HIV-1 replication is enhanced by PDE8A
25229150 a novel and critical role for phosphodiesterases in moderating local concentrations of cAMP in microdomains and signal resetting
23509299 PDE8A can bind tightly to Raf-1, regulate Raf-1 phosphorylation on S259, and, in so doing, regulate the cross-talk node whereby cAMP exerts an inhibitory effect on Raf-1 signaling, retarding subsequent ERK phosphorylation and activation.
22673573 PDE8 activity can be modulated by a kinase
21920574 Polymorphism in PDE8A affects HIV-1 replication in primary macrophages.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19482904 The findings exclude a significant role for PDE8A as a PCOS candidate gene, and as a Las major determinant of androgen levels in women.
More...

AA Sequence

MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQF      1 - 70
GPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFLDKHHDIIIIDHRNPRQLDA     71 - 140
EALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGFTRRYVENPNIMACYNELLQLEFGEVRSQLK    141 - 210
LRACNSVFTALENSEDAIEITSEDRFIQYANPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCI    211 - 280
RIGKEWQGIYYAKKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTG    281 - 350
KHKDRRKGSLDVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLE    351 - 420
ILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPISLDDVPPRIAR    421 - 490
AMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTH    491 - 560
SADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHA    561 - 630
ALAFQLTTGDDKCNIFKNMERNDYRTLRQGIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKN    631 - 700
QEVINTMLRTPENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRN    701 - 770
TCSIPKSQISFIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLRPPPE               771 - 829
//

Text Mined References (28)

PMID Year Title
25295610 2014 Phosphodiesterase 8a supports HIV-1 replication in macrophages at the level of reverse transcription.
25229150 2014 Active site coupling in PDE:PKA complexes promotes resetting of mammalian cAMP signaling.
23568457 2013 Genetic variants associated with disordered eating.
23509299 2013 Phosphodiesterase-8A binds to and regulates Raf-1 kinase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22673573 2012 Cyclic AMP-specific phosphodiesterase, PDE8A1, is activated by protein kinase A-mediated phosphorylation.
21920574 2011 Polymorphism in HIV-1 dependency factor PDE8A affects mRNA level and HIV-1 replication in primary macrophages.
20719862 2010 New loci associated with central cornea thickness include COL5A1, AKAP13 and AVGR8.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...