Property Summary

Ligand Count 9
NCBI Gene PubMed Count 24
PubMed Score 22.39
PubTator Score 18.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.300 4.1e-02
colon cancer -1.300 2.1e-02
Down syndrome 1.200 8.0e-03
group 4 medulloblastoma -2.000 3.2e-04
osteosarcoma 1.722 2.3e-04
ovarian cancer -1.800 3.0e-06
Pick disease -1.800 8.5e-05
posterior fossa group A ependymoma 1.200 2.2e-04
progressive supranuclear palsy -1.900 7.7e-03

Gene RIF (16)

AA Sequence

MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQF      1 - 70
GPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFLDKHHDIIIIDHRNPRQLDA     71 - 140
EALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGFTRRYVENPNIMACYNELLQLEFGEVRSQLK    141 - 210
LRACNSVFTALENSEDAIEITSEDRFIQYANPAFETTMGYQSGELIGKELGEVPINEKKADLLDTINSCI    211 - 280
RIGKEWQGIYYAKKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTG    281 - 350
KHKDRRKGSLDVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLE    351 - 420
ILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPISLDDVPPRIAR    421 - 490
AMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTH    491 - 560
SADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHA    561 - 630
ALAFQLTTGDDKCNIFKNMERNDYRTLRQGIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKN    631 - 700
QEVINTMLRTPENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRN    701 - 770
TCSIPKSQISFIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLRPPPE               771 - 829
//

Text Mined References (29)

PMID Year Title