Property Summary

NCBI Gene PubMed Count 160
Grant Count 2
Funding $114,474.95
PubMed Score 144.67
PubTator Score 232.74

Knowledge Summary

Patent

No data available

Synonym

Accession O60656 B8K285 P36509 Q9HAX0 UDPGT 1-9
Symbols LUGP4
UDPGT
UGT1I
HLUGP4
UGT-1I
UGT1-9
UGT1.9
UGT1AI
UGT1-09
UGT1A9S
UDPGT 1-9

Gene

 Grant Application (2)

Gene RIF (111)

PMID Text
26407805 UGT1A9 contributes to the in-vitro glucuronidation of arctigenin in liver microsomes.
26247833 the in vitro glucuronidation of raloxifene in humans and monkeys was examined using liver and intestinal microsomes and recombinant UGT enzymes (UGT1A1, UGT1A8 and UGT1A9).
26010150 in tumor liver microsomes from HCC patients, either V(max) (maximum reaction rate, R(max) for UGT1A1) or clearance rates (V(max)/K(m), Clint) of UGT1A, UGT1A1, UGT1A4, UGT1A9 and UGT2B7 were lower than those in the adjacent normal liver microsomes
25547628 UGT1A10 exhibited somewhat higher BPA glucuronidation activity than UGT1A9, but it was lower than UGT2A1 and UGT2B15. 4.
25446781 We observed statistically significant associations between SNP and Drug-induced liver injury at both allele and genotype levels of of UGT1A9 promoter
25380893 Significantly lower estimated glomerular filtration rate of the renal allograft in UGT1A9 c.98C carriers did not translate into decreased allograft survival.
24470170 Suggest that the enzymatic properties of UGT1A9 are considerably different between humans and cynomolgus monkeys, although humUGT1A9 and monUGT1A9 were highly conserved at the amino acid level.
24453052 Data shows that UGT1A9*22 allele was significantly less frequent in the Uzbek population compared to the Japanese.
24092055 In HeLa cells overexpressing UGT1A9 there was an increase in catalysis and production of luteolin glucuronides.
24025985 UGT1A9 is the major isoform responsible for the glucuronidations of fraxetin in liver microsomes.
More...

AA Sequence

MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSL      1 - 70
NCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKES     71 - 140
SFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNH    141 - 210
IMHLEEHLLCHRFFKNALEIASEILQTPVTEYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQG    211 - 280
KPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK    281 - 350
WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL    351 - 420
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG    421 - 490
FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                                  491 - 530
//

Text Mined References (163)

PMID Year Title
26407805 2015 Identification and characterization of human UDP-glucuronosyltransferases responsible for the in-vitro glucuronidation of arctigenin.
26247833 2016 Raloxifene glucuronidation in liver and intestinal microsomes of humans and monkeys: contribution of UGT1A1, UGT1A8 and UGT1A9.
26010150 2015 Drug-Metabolizing Activity, Protein and Gene Expression of UDP-Glucuronosyltransferases Are Significantly Altered in Hepatocellular Carcinoma Patients.
25547628 2015 Differences in the glucuronidation of bisphenols F and S between two homologous human UGT enzymes, 1A9 and 1A10.
25446781 2015 Association study of UGT1A9 promoter polymorphisms with DILI based on systematically regional variation screen in Chinese population.
25380893 2014 Recipient uridine 5'-diphospho-glucuronosyltransferase UGT1A9 c.98T>C variant determines transplanted kidney filtration rate.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24470170 2014 Functional characterization of cynomolgus monkey UDP-glucuronosyltransferase 1A9.
More...