Property Summary

NCBI Gene PubMed Count 168
PubMed Score 148.01
PubTator Score 232.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

 CSPA Cell Line (3)

Protein-protein Interaction (3)

Gene RIF (119)

AA Sequence

MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSL      1 - 70
NCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKES     71 - 140
SFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNH    141 - 210
IMHLEEHLLCHRFFKNALEIASEILQTPVTEYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQG    211 - 280
KPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK    281 - 350
WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL    351 - 420
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG    421 - 490
FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                                  491 - 530
//

Text Mined References (171)

PMID Year Title