Property Summary

NCBI Gene PubMed Count 23
Grant Count 64
R01 Count 46
Funding $6,665,265.31
PubMed Score 39.85
PubTator Score 34.02

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O60645 Q6P2E8 Q8TEN6 Q8WUW0 Q96DI4
Symbols SEC6
Sec6p
SEC6L1

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
26350970 HIV-1 Nef interacts with EXOC3 and this interaction is dependent on the GTPase interaction site of PAK2
26283729 The study explores the role of the exocyst complex component Sec6/8 in genomic stability.
26247921 Sec6 regulates NF-kappaB transcriptional activity via the control of the phosphorylation of IkappaBalpha, p90RSK1, and ERK
24949832 Sec6 regulates cytoplasmic translocation of p27 through p27 phosphorylation at Thr157, thereby promoting p27 degradation in the cytoplasm via interaction with Jab1 and Siah1 and suppressing cell cycle progression.
22534017 HIV-1 Nef interacts with EXOC3 and this interaction is dependent on the GTPase interaction site of PAK2
22381337 Data demonstrate that the expression of alpha-E-catenin is increased by Sec6 siRNAs, and E-cadherin and beta-catenin localize mainly at the cell-cell contact region in HSC3 cells, which were transfected with Sec6 siRNA.

AA Sequence

MQCEDSTSFFTMKETDREAVATAVQRVAGMLQRPDQLDKVEQYRRREARKKASVEARLKAAIQSQLDGVR      1 - 70
TGLSQLHNALNDVKDIQQSLADVSKDWRQSINTIESLKDVKDAVVQHSQLAAAVENLKNIFSVPEIVRET     71 - 140
QDLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMVLQRSL    141 - 210
VTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFTILERTVTTRIEGTQADTRE    211 - 280
SDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCFPPHYEIFKNLLNMYHQALSTRMQDLASEDLEANEIVSL    281 - 350
LTWVLNTYTSTEMMRNVELAPEVDVGTLEPLLSPHVVSELLDTYMSTLTSNIIAWLRKALETDKKDWVKE    351 - 420
TEPEADQDGYYQTTLPAIVFQMFEQNLQVAAQISEDLKTKVLVLCLQQMNSFLSRYKDEAQLYKEEHLRN    421 - 490
RQHPHCYVQYMIAIINNCQTFKESIVSLKRKYLKNEVEEGVSPSQPSMDGILDAIAKEGCSGLLEEVFLD    491 - 560
LEQHLNELMTKKWLLGSNAVDIICVTVEDYFNDFAKIKKPYKKRMTAEAHRRVVVEYLRAVMQKRISFRS    561 - 630
PEERKEGAEKMVREAEQLRFLFRKLASGFGEDVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIR    631 - 700
DDHIGALLAVRGDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK                  701 - 756
//

Text Mined References (27)

PMID Year Title
26283729 2015 Role of the Exocyst Complex Component Sec6/8 in Genomic Stability.
26247921 2016 Nuclear Translocation of p65 is Controlled by Sec6 via the Degradation of I?B?.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24949832 2014 Sec6 regulated cytoplasmic translocation and degradation of p27 via interactions with Jab1 and Siah1.
22381337 2012 Knockdown of Sec6 improves cell-cell adhesion by increasing ?-E-catenin in oral cancer cells.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21269460 2011 Initial characterization of the human central proteome.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
More...