Property Summary

NCBI Gene PubMed Count 32
PubMed Score 80.39
PubTator Score 174.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.40702038856548E-70
posterior fossa group A ependymoma 1511 9.80677472244069E-16
oligodendroglioma 2849 9.0210671030554E-9
psoriasis 6685 2.47824773648911E-7
pilocytic astrocytoma 3086 6.57013162369125E-7
medulloblastoma, large-cell 6234 1.01990783408658E-6
pediatric high grade glioma 2712 1.02266498847764E-6
pituitary cancer 1972 2.1995015244938E-5
medulloblastoma 1524 2.34253435010566E-5
atypical teratoid / rhabdoid tumor 4369 3.56739182696999E-5
glioblastoma 5572 8.79707969919692E-5
primitive neuroectodermal tumor 3031 1.64880623985297E-4
astrocytoma 1493 0.00357921731065841
Pick disease 1893 0.018631295335568

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -3.600 0.004
posterior fossa group A ependymoma -3.500 0.000
glioblastoma -4.700 0.000
oligodendroglioma -1.900 0.000
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -1.800 0.000
pediatric high grade glioma -4.100 0.000
pilocytic astrocytoma -1.900 0.000
lung carcinoma 4.600 0.000
Pick disease -1.900 0.019
pituitary cancer 1.100 0.000
psoriasis -1.200 0.000

Synonym

Accession O60641 A8K0L7 E5RI02 Q5JX13 Q68DL9 Q6P9D3 Q9NTY7
Symbols CALM
AP180

Gene

  Ortholog (14)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (13)

PMID Text
26412491 To sustain efficient neurotransmission and synaptic vesicle formation, AP180 and VAMP2 are required.
26204806 intrinsically disordered domains are highly potent drivers of membrane curvature
23678185 AP180 depletion by shRNA results in inhibition of the HIV-1 CA uptake by target cells
22639918 AP180 and CALM are endocytic adaptors dedicated to the sorting of small soluble N-ethylmaleimide-sensitive-factor attachment protein receptors. (Review)
22479182 AP180 depletion by shRNA results in inhibition of the HIV-1 CA uptake by target cells
21813615 AP180 depletion by shRNA results in inhibition of the HIV-1 CA uptake by target cells
21808019 unique mechanism of SNARE motif-dependent endocytic sorting and identify the ANTH domain proteins AP180 and CALM as cargo-specific adaptors for synaptobrevin endocytosis
20847448 AP180 is significantly decreased in the hippocampus of Alzheimer's disease patients and in hippocampal neurons of transgenic mice.
20511563 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MSGQTLTDRIAAAQYSVTGSAVARAVCKATTHEVMGPKKKHLDYLIQATNETNVNIPQMADTLFERATNS      1 - 70
SWVVVFKALVTTHHLMVHGNERFIQYLASRNTLFNLSNFLDKSGSHGYDMSTFIRRYSRYLNEKAFSYRQ     71 - 140
MAFDFARVKKGADGVMRTMAPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLLFKDLIKLFAC    141 - 210
YNDGVINLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEFLKVAEQVGIDKGDIPDLTQAPSSLMETLEQ    211 - 280
HLNTLEGKKPGNNEGSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLL    281 - 350
DLQPDFSSGGAAAAAAPAPPPPAGGATAWGDLLGEDSLAALSSVPSEAQISDPFAPEPTPPTTTAEIATA    351 - 420
SASASTTTTVTAVTAEVDLFGDAFAASPGEAPAASEGAAAPATPTPVAAALDACSGNDPFAPSEGSAEAA    421 - 490
PELDLFAMKPPETSVPVVTPTASTAPPVPATAPSPAPAVAAAAAATTAATAAATTTTTTSAATATTAPPA    491 - 560
LDIFGDLFESTPEVAAAPKPDAAPSIDLFSTDAFSSPPQGASPVPESSLTADLLSVDAFAAPSPATTASP    561 - 630
AKVDSSGVIDLFGDAFGSSASEPQPASQAASSSSASADLLAGFGGSFMAPSPSPVTPAQNNLLQPNFEAA    631 - 700
FGTTPSTSSSSSFDPSVFDGLGDLLMPTMAPAGQPAPVSMVPPSPAMAASKALGSDLDSSLASLVGNLGI    701 - 770
SGTTTKKGDLQWNAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVPPTSSVPPVAGAPSVGQPGAGF    771 - 840
GMPPAGTGMPMMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPASQSPKKPPAKDPLADLNIKDFL       841 - 907
//

Text Mined References (35)

PMID Year Title
26412491 2015 Vesicular Synaptobrevin/VAMP2 Levels Guarded by AP180 Control Efficient Neurotransmission.
26204806 2015 Intrinsically disordered proteins drive membrane curvature.
23092984 2012 Genome-wide association of mood-incongruent psychotic bipolar disorder.
22639918 2012 Turning CALM into excitement: AP180 and CALM in endocytosis and disease.
21808019 2011 SNARE motif-mediated sorting of synaptobrevin by the endocytic adaptors clathrin assembly lymphoid myeloid leukemia (CALM) and AP180 at synapses.
20847448 2010 Changed clathrin regulatory proteins in the brains of Alzheimer's disease patients and animal models.
20511563 2010 Novel cleft susceptibility genes in chromosome 6q.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19450545 2009 The clathrin assembly protein AP180 regulates the generation of amyloid-beta peptide.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
More...