Property Summary

NCBI Gene PubMed Count 33
PubMed Score 82.61
PubTator Score 174.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -4.100 3.7e-06
astrocytic glioma -1.900 7.8e-03
Astrocytoma, Pilocytic -1.900 9.6e-07
atypical teratoid / rhabdoid tumor -3.800 3.6e-05
ependymoma -2.900 3.6e-02
glioblastoma -3.800 7.9e-07
group 3 medulloblastoma -1.300 3.0e-02
lung carcinoma 4.600 4.4e-70
medulloblastoma, large-cell -3.600 1.0e-06
oligodendroglioma -1.900 9.0e-09
Pick disease -1.900 1.9e-02
pituitary cancer 1.100 2.2e-05
primitive neuroectodermal tumor -1.800 1.6e-04
psoriasis -1.200 2.5e-07

Gene RIF (14)

AA Sequence

MSGQTLTDRIAAAQYSVTGSAVARAVCKATTHEVMGPKKKHLDYLIQATNETNVNIPQMADTLFERATNS      1 - 70
SWVVVFKALVTTHHLMVHGNERFIQYLASRNTLFNLSNFLDKSGSHGYDMSTFIRRYSRYLNEKAFSYRQ     71 - 140
MAFDFARVKKGADGVMRTMAPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLLFKDLIKLFAC    141 - 210
YNDGVINLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEFLKVAEQVGIDKGDIPDLTQAPSSLMETLEQ    211 - 280
HLNTLEGKKPGNNEGSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLL    281 - 350
DLQPDFSSGGAAAAAAPAPPPPAGGATAWGDLLGEDSLAALSSVPSEAQISDPFAPEPTPPTTTAEIATA    351 - 420
SASASTTTTVTAVTAEVDLFGDAFAASPGEAPAASEGAAAPATPTPVAAALDACSGNDPFAPSEGSAEAA    421 - 490
PELDLFAMKPPETSVPVVTPTASTAPPVPATAPSPAPAVAAAAAATTAATAAATTTTTTSAATATTAPPA    491 - 560
LDIFGDLFESTPEVAAAPKPDAAPSIDLFSTDAFSSPPQGASPVPESSLTADLLSVDAFAAPSPATTASP    561 - 630
AKVDSSGVIDLFGDAFGSSASEPQPASQAASSSSASADLLAGFGGSFMAPSPSPVTPAQNNLLQPNFEAA    631 - 700
FGTTPSTSSSSSFDPSVFDGLGDLLMPTMAPAGQPAPVSMVPPSPAMAASKALGSDLDSSLASLVGNLGI    701 - 770
SGTTTKKGDLQWNAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVPPTSSVPPVAGAPSVGQPGAGF    771 - 840
GMPPAGTGMPMMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPASQSPKKPPAKDPLADLNIKDFL       841 - 907
//

Text Mined References (36)

PMID Year Title