Property Summary

NCBI Gene PubMed Count 32
Grant Count 36
R01 Count 26
Funding $4,173,486.79
PubMed Score 80.39
PubTator Score 174.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -3.600 0.004
posterior fossa group A ependymoma -3.500 0.000
glioblastoma -4.700 0.000
oligodendroglioma -1.900 0.000
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -1.800 0.000
pediatric high grade glioma -4.100 0.000
pilocytic astrocytoma -1.900 0.000
lung carcinoma 4.600 0.000
Pick disease -1.900 0.019
pituitary cancer 1.100 0.000
psoriasis -1.200 0.000

Gene RIF (13)

PMID Text
26412491 To sustain efficient neurotransmission and synaptic vesicle formation, AP180 and VAMP2 are required.
26204806 intrinsically disordered domains are highly potent drivers of membrane curvature
23678185 AP180 depletion by shRNA results in inhibition of the HIV-1 CA uptake by target cells
22639918 AP180 and CALM are endocytic adaptors dedicated to the sorting of small soluble N-ethylmaleimide-sensitive-factor attachment protein receptors. (Review)
22479182 AP180 depletion by shRNA results in inhibition of the HIV-1 CA uptake by target cells
21813615 AP180 depletion by shRNA results in inhibition of the HIV-1 CA uptake by target cells
21808019 unique mechanism of SNARE motif-dependent endocytic sorting and identify the ANTH domain proteins AP180 and CALM as cargo-specific adaptors for synaptobrevin endocytosis
20847448 AP180 is significantly decreased in the hippocampus of Alzheimer's disease patients and in hippocampal neurons of transgenic mice.
20511563 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MSGQTLTDRIAAAQYSVTGSAVARAVCKATTHEVMGPKKKHLDYLIQATNETNVNIPQMADTLFERATNS      1 - 70
SWVVVFKALVTTHHLMVHGNERFIQYLASRNTLFNLSNFLDKSGSHGYDMSTFIRRYSRYLNEKAFSYRQ     71 - 140
MAFDFARVKKGADGVMRTMAPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLLFKDLIKLFAC    141 - 210
YNDGVINLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEFLKVAEQVGIDKGDIPDLTQAPSSLMETLEQ    211 - 280
HLNTLEGKKPGNNEGSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLL    281 - 350
DLQPDFSSGGAAAAAAPAPPPPAGGATAWGDLLGEDSLAALSSVPSEAQISDPFAPEPTPPTTTAEIATA    351 - 420
SASASTTTTVTAVTAEVDLFGDAFAASPGEAPAASEGAAAPATPTPVAAALDACSGNDPFAPSEGSAEAA    421 - 490
PELDLFAMKPPETSVPVVTPTASTAPPVPATAPSPAPAVAAAAAATTAATAAATTTTTTSAATATTAPPA    491 - 560
LDIFGDLFESTPEVAAAPKPDAAPSIDLFSTDAFSSPPQGASPVPESSLTADLLSVDAFAAPSPATTASP    561 - 630
AKVDSSGVIDLFGDAFGSSASEPQPASQAASSSSASADLLAGFGGSFMAPSPSPVTPAQNNLLQPNFEAA    631 - 700
FGTTPSTSSSSSFDPSVFDGLGDLLMPTMAPAGQPAPVSMVPPSPAMAASKALGSDLDSSLASLVGNLGI    701 - 770
SGTTTKKGDLQWNAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVPPTSSVPPVAGAPSVGQPGAGF    771 - 840
GMPPAGTGMPMMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPASQSPKKPPAKDPLADLNIKDFL       841 - 907
//

Text Mined References (35)

PMID Year Title
26412491 2015 Vesicular Synaptobrevin/VAMP2 Levels Guarded by AP180 Control Efficient Neurotransmission.
26204806 2015 Intrinsically disordered proteins drive membrane curvature.
23092984 2012 Genome-wide association of mood-incongruent psychotic bipolar disorder.
22639918 2012 Turning CALM into excitement: AP180 and CALM in endocytosis and disease.
21808019 2011 SNARE motif-mediated sorting of synaptobrevin by the endocytic adaptors clathrin assembly lymphoid myeloid leukemia (CALM) and AP180 at synapses.
20847448 2010 Changed clathrin regulatory proteins in the brains of Alzheimer's disease patients and animal models.
20511563 2010 Novel cleft susceptibility genes in chromosome 6q.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19450545 2009 The clathrin assembly protein AP180 regulates the generation of amyloid-beta peptide.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
More...