Property Summary

NCBI Gene PubMed Count 14
PubMed Score 14.40
PubTator Score 105.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (4)

PMID Text
24726368 TSPAN2 is identified as a factor responsible for invasion, motility, and metastasis.
23294458 the C-allele of rs2078371 near TSPAN-2 also reached genome-wide significance for association with migraine.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGRFRGGLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGAIKELSSEDKSPEYFYVGLYVLVGAGALMM      1 - 70
AVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNG     71 - 140
TLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQLIGIVGIGIAGLTIFGMIFSMVL    141 - 210
CCAIRNSRDVI                                                               211 - 221
//

Text Mined References (14)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
24726368 2014 TSPAN2 is involved in cell invasion and motility during lung cancer progression.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23294458 2013 Replication and meta-analysis of common variants identifies a genome-wide significant locus in migraine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...