Property Summary

NCBI Gene PubMed Count 28
PubMed Score 40.82
PubTator Score 29.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.7140867676182E-41
nasopharyngeal carcinoma 1056 1.56568728603369E-7
pancreatic cancer 2300 2.4170443821569E-7
intraductal papillary-mucinous adenoma (IPMA) 2956 1.28693905524209E-4
osteosarcoma 7933 1.71321048657023E-4
ovarian cancer 8492 1.96435495355992E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.1752853007799E-4
Breast cancer 3099 8.91888308110528E-4
fibroadenoma 557 0.00373891793503993
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00398021262238691
pituitary cancer 1972 0.00466582877992394
interstitial cystitis 2299 0.00804375045128378
nephrosclerosis 329 0.00942017158942226
colon cancer 1475 0.0103022622995865
breast carcinoma 1614 0.0110197330094382
esophageal adenocarcinoma 737 0.0214020317316477
urothelial carcinoma 318 0.0246397057787074
invasive ductal carcinoma 2950 0.0264591147975481
primary pancreatic ductal adenocarcinoma 1271 0.0360441716974925
Barrett's esophagus 185 0.0445337307903822

Expression

Synonym

Accession O60635 D3DQ14 O60745 Q5VST0 Tspan-1
Symbols NET1
TM4C
TM4SF

Gene

  Ortholog (10)

Gene RIF (17)

PMID Text
26370588 The present study demonstrated that Tspan1 plays an important role in Pancreatic cancer carcinogenic progression, including migration and invasion.
26054975 Restoration of TSPAN1 rescued the effects of miR-573 overexpression. Therefore, our findings suggest that the miR-573/TSPAN1 axis is important in the control of gastric carcinogenesis
25301729 our current data demonstrate that miR-638 functions as a tumor suppressor in human colorectal carcinoma by inhibiting TSPAN1
23938385 TSPAN1 was proved to induce migration, and so up-regulation of TSPAN1 by miR-200a may explain why over-expressing miR-200a promotes NSCLC cells migration
23754316 these data argue against a role for tetraspanin 1 as a genuine mediator of cell surface receptor signalling but rather document a role for tetraspanin 1 in the control of cervical cancer cell motility and invasion.
22378020 data suggest that the NET-1 gene may play an important role in proliferation, migration and endocytosis in the development and progress of hepatocellular carcinoma
22088470 Study provided the gene expression profile of HBV-related HCC and presented differential expression patterns of SATB-1, TM4SF-1 and ST-14 between cancerous and noncancerous tissues in patients with HBV-related HCC.
21836059 These studies demonstrate for the first time that Tspan-1 is an interacting partner with human thiamine transporter-1 and that this interaction affects thiamine transporter-1 stability.
21302622 RNAi-mediated downregulation of TSPAN1 expression significantly inhibits the proliferation and invasion of colon cancer cells in vitro.
20890423 The overexpression of Tspan-1 was found in HCC tissues, positively correlated with clinical stage and negatively correlated with survival rate.
More...

AA Sequence

MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFAL      1 - 70
GFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVW     71 - 140
NTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRT    141 - 210
NAVTVGGVAAGIGGLELAAMIVSMYLYCNLQ                                           211 - 241
//

Text Mined References (30)

PMID Year Title
26370588 2015 Tetraspanin 1 is involved in survival, proliferation and carcinogenesis of pancreatic cancer.
26054975 2015 TSPAN1 functions as an oncogene in gastric cancer and is downregulated by miR-573.
25301729 2014 MicroRNA-638 inhibits cell proliferation, invasion and regulates cell cycle by targeting tetraspanin 1 in human colorectal carcinoma.
23938385 2013 MiR-200a enhances the migrations of A549 and SK-MES-1 cells by regulating the expression of TSPAN1.
23754316 2013 Tetraspanin 1 promotes invasiveness of cervical cancer cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22378020 2012 The effect of NET-1 on the proliferation, migration and endocytosis of the SMMC-7721 HCC cell line.
22088470 2011 Genomics of hepatitis B virus-related hepatocellular carcinoma and adjacent noncancerous tissues with cDNA microarray.
21836059 2011 Tspan-1 interacts with the thiamine transporter-1 in human intestinal epithelial cells and modulates its stability.
More...