Property Summary

NCBI Gene PubMed Count 28
PubMed Score 39.96
PubTator Score 29.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Barrett's esophagus 2.500 4.5e-02
Breast cancer 1.400 8.9e-04
breast carcinoma 1.100 1.1e-02
colon cancer -2.400 1.0e-02
esophageal adenocarcinoma 1.800 2.1e-02
fibroadenoma 1.800 3.7e-03
interstitial cystitis -1.800 8.0e-03
intraductal papillary-mucinous adenoma (... 3.200 1.3e-04
intraductal papillary-mucinous carcinoma... 2.800 4.2e-04
intraductal papillary-mucinous neoplasm ... 2.800 4.0e-03
invasive ductal carcinoma 1.700 2.6e-02
nasopharyngeal carcinoma -3.000 1.6e-07
nephrosclerosis -1.518 9.4e-03
osteosarcoma 1.071 1.7e-04
ovarian cancer 1.500 2.0e-04
pancreatic cancer 2.700 2.4e-07
pituitary cancer 1.400 4.7e-03
primary pancreatic ductal adenocarcinoma 1.862 3.6e-02
psoriasis -1.200 1.7e-41
urothelial carcinoma -2.300 2.5e-02

Gene RIF (17)

AA Sequence

MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFAL      1 - 70
GFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVW     71 - 140
NTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRT    141 - 210
NAVTVGGVAAGIGGLELAAMIVSMYLYCNLQ                                           211 - 241
//

Text Mined References (30)

PMID Year Title