Property Summary

NCBI Gene PubMed Count 27
Grant Count 30
R01 Count 18
Funding $4,440,351.49
PubMed Score 39.50
PubTator Score 32.21

Knowledge Summary

Patent

No data available

Gene RIF (18)

PMID Text
25728752 Results suggest that SEP15 plays important roles in the regulation of the G1 phase during the cell cycle as well as in cell motility of Chang liver cells offering a novel functional link between the cell cycle and cell motility.
25529450 Sep15 in Chang liver cells regulates the pathway that antagonizes RhoA/ROCK/MLC-dependent non-apoptotic bleb formation.
25249019 Concerning rs561104, the serum selenium concentration was higher in CC homozygotes (5.65 +/- 1.11 mug/dL) compared with T carriers (4.88 +/- 1.25 mug/dL, P = .044).
21052528 Observational study of gene-disease association. (HuGE Navigator)
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20852007 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20424130 This study provides evidence that SEP15 genetic variation may influence prostate cancer mortality
20424130 Observational study of gene-disease association. (HuGE Navigator)
20378690 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGC      1 - 70
CQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEE     71 - 140
LSILKWNTDSVEEFLSEKLERI                                                    141 - 162
//

Text Mined References (28)

PMID Year Title
25728752 2015 Cell Proliferation and Motility Are Inhibited by G1 Phase Arrest in 15-kDa Selenoprotein-Deficient Chang Liver Cells.
25529450 2015 Deficiency of the 15-kDa selenoprotein led to cytoskeleton remodeling and non-apoptotic membrane blebbing through a RhoA/ROCK pathway.
25249019 2014 SLC30A3 and SEP15 gene polymorphisms influence the serum concentrations of zinc and selenium in mature adults.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21052528 2010 Polymorphisms in the selenoprotein S and 15-kDa selenoprotein genes are associated with altered susceptibility to colorectal cancer.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20852007 2010 Effects of selenium status and polymorphisms in selenoprotein genes on prostate cancer risk in a prospective study of European men.
20424130 2010 A large prospective study of SEP15 genetic variation, interaction with plasma selenium levels, and prostate cancer risk and survival.
20378690 2010 Genetic variants in selenoprotein genes increase risk of colorectal cancer.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
More...