Property Summary

NCBI Gene PubMed Count 29
PubMed Score 41.54
PubTator Score 32.21

Knowledge Summary

Patent

No data available

Gene RIF (20)

AA Sequence

MAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGC      1 - 70
CQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEE     71 - 140
LSILKWNTDSVEEFLSEKLERI                                                    141 - 162
//

Text Mined References (33)

PMID Year Title