Property Summary

NCBI Gene PubMed Count 23
PubMed Score 5.03
PubTator Score 20.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Gene

PDB

2GH0  

Gene RIF (9)

PMID Text
23351331 The expression of GFRalpha1 and/or GFRalpha3, especially when combined with ARTN expression, may be useful predictors of disease progression and outcome in specific subtypes of mammary carcinoma.
22031517 The lack of expression of the RET/GFRA system could be related to the cell mislocation and deregulated growth of craniopharyngiomas.
20116071 This study found nominally-significant evidence for interactions between GFRA1, 2 and 3 associated with schizophrenia and clozapine response, consistent with the locations of these three genes within linkage regions for schizophrenia.
20116071 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19304517 Artemin and GFRalpha3 expressions may play an important role in perineural invasion of pancreatic carcinoma.
16773224 In the human digestive and reproductive systems, a subset of epithelial cells exhibited GFRalpha3- and RET-like staining, suggesting co-localization.
16765900 1.92 A crystal structure of the complex formed between ARTN and its receptor GFRalpha3 was reported.
12624147 Observational study of gene-disease association. (HuGE Navigator)
12490080 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVRPLNPRPLPPVVLMLLLLLPPSPLPLAAGDPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSS      1 - 70
ISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTV     71 - 140
TSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEP    141 - 210
HAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGT    211 - 280
CATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMR    281 - 350
FHSQLFSQDWPHPTFAVMAHQNENPAVRPQPWVPSLFSCTLPLILLLSLW                        351 - 400
//

Text Mined References (24)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
23351331 2013 Prognostic significance of the expression of GFR?1, GFR?3 and syndecan-3, proteins binding ARTEMIN, in mammary carcinoma.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22031517 2012 Craniopharyngiomas express embryonic stem cell markers (SOX2, OCT4, KLF4, and SOX9) as pituitary stem cells but do not coexpress RET/GFRA3 receptors.
20116071 2010 Genetic association of the GDNF alpha-receptor genes with schizophrenia and clozapine response.
19304517 2009 [Artemin and GFRalpha3 expressions and their relevance to perineural invasiveness and metastasis of pancreatic carcinoma].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16773224 2006 Distribution of GDNF family receptor alpha3 and RET in rat and human non-neural tissues.
16765900 2006 Structure of artemin complexed with its receptor GFRalpha3: convergent recognition of glial cell line-derived neurotrophic factors.
More...