Property Summary

NCBI Gene PubMed Count 24
PubMed Score 4.93
PubTator Score 20.36

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
interstitial cystitis 1.600 4.2e-03
intraductal papillary-mucinous adenoma (... -1.300 3.1e-04
intraductal papillary-mucinous neoplasm ... -1.400 2.7e-03
lung carcinoma 4.700 3.3e-15
non-small cell lung carcinoma 1.100 4.4e-08
osteosarcoma 1.266 3.1e-02
psoriasis -1.300 5.2e-41

Gene RIF (10)

AA Sequence

MVRPLNPRPLPPVVLMLLLLLPPSPLPLAAGDPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSS      1 - 70
ISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTV     71 - 140
TSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEP    141 - 210
HAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGT    211 - 280
CATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMR    281 - 350
FHSQLFSQDWPHPTFAVMAHQNENPAVRPQPWVPSLFSCTLPLILLLSLW                        351 - 400
//

Text Mined References (25)

PMID Year Title