Property Summary

NCBI Gene PubMed Count 1,156
PubMed Score 3173.48
PubTator Score 1673.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 2.9064131108822E-30
ovarian cancer 8492 1.77820956398587E-8
Breast cancer 3099 4.5395225590521E-7
interstitial cystitis 2299 6.35966194472675E-6
pilocytic astrocytoma 3086 9.92457789976389E-6
lung cancer 4473 8.81972809253451E-5
glioblastoma 5572 2.88999438863891E-4
medulloblastoma, large-cell 6234 0.00108751185559178
ulcerative colitis 2087 0.00148188760019904
cutaneous lupus erythematosus 1056 0.00162830753699376
psoriasis 6685 0.00293713674825587
invasive ductal carcinoma 2950 0.0045479355244933
subependymal giant cell astrocytoma 2287 0.00805435110884586
gastric carcinoma 832 0.0272986510003523
Disease Target Count
Carcinoma of colon 32
Leprosy 3 1

Expression

  Differential Expression (14)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 0.002
psoriasis 1.100 0.003
glioblastoma 2.800 0.000
medulloblastoma, large-cell -1.100 0.001
lung cancer -3.200 0.000
interstitial cystitis 1.600 0.000
pilocytic astrocytoma 1.400 0.000
subependymal giant cell astrocytoma 2.381 0.008
invasive ductal carcinoma 1.197 0.005
lung carcinoma -2.700 0.000
Breast cancer -1.400 0.000
gastric carcinoma 1.200 0.027
ulcerative colitis 1.400 0.001
ovarian cancer -1.900 0.000

Synonym

Accession O60603 B3Y612 D1CS45 D1CS48 D1CS49 O15454 Q8NI00
Symbols TIL4
CD282

Gene

PANTHER Protein Class (1)

PDB

2Z7X   1FYW   1FYX   1O77   2Z80  

  Ortholog (12)

Gene RIF (1179)

PMID Text
27090786 Data show that genetic ablation of Toll-like receptor 2 (TLR2) by siRNA and TLR2-neutralizing antibody could block NF-kappa B (NF-kappaB) activation by exosomes.
27084682 Asthmatic subjects with high total serum IgE show increased macrophage expression of TLR4 in induced sputum.
27079437 these results suggest that targeting the COX-2/PGE2 pathway together with TLR/MyD88 signaling, which would suppress the inflammatory microenvironment and maintenance of stemness, could be an effective preventive or therapeutic strategy for gastric cancer
27029120 Association of infectious pathology of upper respiratory tract and development of periodontitis diseases with markers in DEFB1 (-44G/C) and TLR2 Arg753Gln and Arg677Trp genes was determined.
26963509 study represents the first analysis demonstrating that harbouring polymorphisms of Dectin-1 (rs7309123) or TLR2 (rs5743708) represents an independent risk factor of developing IFD in patients with AML undergoing induction chemotherapy.
26950997 In periodontitis, TLR2 gene hyperexpression was accompanied by the reduction of expression of anti-microbial peptide HBD-2, as well as in an increase of production of TNF-alpha and TGF-beta by epithelial cells of periodontium mucosa.
26794428 Human acute myeloid leukaemia cell line MUTZ-LCs revealed high TLR2 expression and responded robustly to TLR2 engagement, confirmed by increased CD83, CD86, PD-L1 and IDO expression, upregulated IL-6, IL-12p40 and IL-23p19 mRNA levels IL-8 release. TLR2 activation reduced CCR6 and elevated CCR7 mRNA expression and induced migration of MUTZ-LCs towards CCL21.
26778002 Taken together, these observations suggest that activation of human mast cells by LL-37 could be modified by TLR2 ligands and the function of human mast cells could be switched from allergic reactions to innate immune response.
26759164 TLR2 expression (and TLR9) is increased in monocyte subsets of active rheumatoid arthritis patients.
26738351 Result suggests that the TLR2 -196 to -174 del polymorphism is an additional risk factor for late-onset Alzheimer disease.
More...

AA Sequence

MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNS      1 - 70
DLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLG     71 - 140
ETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQH    141 - 210
ILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLL    211 - 280
ELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFL    281 - 350
VPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI    351 - 420
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLM    421 - 490
TLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPA    491 - 560
NYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRK    561 - 630
PRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTV    631 - 700
FVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQ    701 - 770
REGFWVNLRAAIKS                                                            771 - 784
//

Text Mined References (1158)

PMID Year Title
27090786 2016 Lung tumor exosomes induce a pro-inflammatory phenotype in mesenchymal stem cells via NF?B-TLR signaling pathway.
27084682 2016 Expression of toll-like receptors 2 and 4 in subjects with asthma by total serum IgE level.
27079437 2016 Inflammation in gastric cancer: Interplay of the COX-2/prostaglandin E2 and Toll-like receptor/MyD88 pathways.
27029120 [ASSOCIATION OF POLYMORPHIC MARKERS IN GENES OF INNATE IMMUNITY IN PATIENTS WITH PERIODONTITIS AND INFLAMMATORY DISEASES OF UPPER RESPIRATORY TRACT].
26963509 2016 Polymorphisms of Dectin-1 and TLR2 Predispose to Invasive Fungal Disease in Patients with Acute Myeloid Leukemia.
26950997 [STUDY OF THE ROLE OF INNATE IMMUNITY FACTORS (TLR2, HBD-2, TNF-?, TGF-?) IN PERIODONTITIS PATHOGENESIS].
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26794428 2016 Acute myeloid leukaemia-derived Langerhans-like cells enhance Th1 polarization upon TLR2 engagement.
26778002 2016 The modulatory effect of TLR2 on LL-37-induced human mast cells activation.
26759164 2016 Overexpression of TLR2 and TLR9 on monocyte subsets of active rheumatoid arthritis patients contributes to enhance responsiveness to TLR agonists.
More...