Property Summary

Ligand Count 4
NCBI Gene PubMed Count 1,259
PubMed Score 3420.91
PubTator Score 1673.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count
Carcinoma of colon 32
Leprosy 3 1

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 1.1e-05
Breast cancer -1.400 4.5e-07
cutaneous lupus erythematosus 1.700 1.6e-03
gastric carcinoma 1.200 2.7e-02
glioblastoma 2.800 2.9e-04
interstitial cystitis 1.500 3.6e-03
invasive ductal carcinoma 1.197 4.5e-03
lung cancer -2.900 1.5e-04
lung carcinoma -2.700 2.9e-30
medulloblastoma, large-cell -1.100 1.1e-03
ovarian cancer -1.900 1.8e-08
psoriasis 1.100 2.9e-03
subependymal giant cell astrocytoma 2.381 8.1e-03
ulcerative colitis 1.400 1.5e-03

Protein-protein Interaction (11)

Gene RIF (1282)

AA Sequence

MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNS      1 - 70
DLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLG     71 - 140
ETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQH    141 - 210
ILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLL    211 - 280
ELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFL    281 - 350
VPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI    351 - 420
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLM    421 - 490
TLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPA    491 - 560
NYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRK    561 - 630
PRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTV    631 - 700
FVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQ    701 - 770
REGFWVNLRAAIKS                                                            771 - 784
//

Text Mined References (1261)

PMID Year Title