Property Summary

NCBI Gene PubMed Count 28
Grant Count 11
R01 Count 11
Funding $452,255.98
PubMed Score 8.45
PubTator Score 13.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma 1.100 0.005
Pick disease -1.300 0.000
progressive supranuclear palsy -1.300 0.023
acute myeloid leukemia 1.200 0.039
ovarian cancer 1.800 0.002
dermatomyositis 1.100 0.000

 MGI Term (1)

Gene RIF (13)

PMID Text
24515107 the release of P-TEFb from the 7SK snRNP led to increased synthesis of HEXIM1 but not HEXIM2
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19883659 The tripartite protein-RNA complex formation between Hexim, Cyclin T and 7SK snRNA, was analyzed.
18391197 TAF7 interacts with the transcription factors, TFIIH and P-TEFb, resulting in the inhibition of their Pol II CTD kinase activities
17452463 These results suggest that acetylation of CDK9 is an important posttranslational modification that is involved in regulating P-TEFb transcriptional elongation function.
16841087 The results establish that cdk9/cyclin T2a-mediated coactivation of MyoD depends on serine 37 phosphorylation.
16331689 Data strengthen the hypothesis that Cyclin T2a plays a role in muscle differentiation, and propose PKNalpha as a novel partner of Cyclin T2a in this process.
15563843 CycT2 not only contains two domains that target rna polymerase II but this substrate recognition is necessary for its transcriptional activity via DNA
12037672 interaction with pRb
10465067 Cyclin T2 competes with cyclin T1 for binding to CDK9 and can thereby inhibit HIV-1 Tat activity
More...

AA Sequence

MASGRGASSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYM      1 - 70
HHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCDAYLQQTQELVILETIML     71 - 140
QTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWE    141 - 210
IPVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQAARKPKVDGQVSETPLLGS    211 - 280
SLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQE    281 - 350
WPQHQDSARTEQLYSQKQETSLSGSQYNINFQQGPSISLHSGLHHRPDKISDHSSVKQEYTHKAGSSKHH    351 - 420
GPISTTPGIIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTSPIKMKIPIAN    421 - 490
TEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSSSDEGSGKSKHSSPHISRDHKEKH    491 - 560
KEHPSSRHHTSSHKHSHSHSGSSSGGSKHSADGIPPTVLRSPVGLSSDGISSSSSSSRKRLHVNDASHNH    561 - 630
HSKMSKSSKSSGSSSSSSSSVKQYISSHNSVFNHPLPPPPPVTYQVGYGHLSTLVKLDKKPVETNGPDAN    631 - 700
HEYSTSSQHMDYKDTFDMLDSLLSAQGMNM                                            701 - 730
//

Text Mined References (37)

PMID Year Title
24515107 2014 Release of positive transcription elongation factor b (P-TEFb) from 7SK small nuclear ribonucleoprotein (snRNP) activates hexamethylene bisacetamide-inducible protein (HEXIM1) transcription.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21509660 2011 HSV-1 stimulation-related protein HSRG1 inhibits viral gene transcriptional elongation by interacting with Cyclin T2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19883659 2010 Specificity of Hexim1 and Hexim2 complex formation with cyclin T1/T2, importin alpha and 7SK snRNA.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...