Property Summary

NCBI Gene PubMed Count 8
PubMed Score 15.40
PubTator Score 14.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MAVRQWVIALALAALLVVDREVPVAAGKLPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLA      1 - 70
RIKTKQDIQIMKDGKC                                                           71 - 86
//

Text Mined References (8)

PMID Year Title