Property Summary

NCBI Gene PubMed Count 8
PubMed Score 14.99
PubTator Score 14.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
17333166 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVRQWVIALALAALLVVDREVPVAAGKLPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLA      1 - 70
RIKTKQDIQIMKDGKC                                                           71 - 86
//

Text Mined References (8)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17333166 2007 The SPINK gene family and celiac disease susceptibility.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12678500 2003 Identification of the bioactive peptide PEC-60 in brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
1400298 1992 Molecular cloning of PEC-60 and expression of its mRNA and peptide in the gastrointestinal tract and immune system.