Property Summary

NCBI Gene PubMed Count 28
PubMed Score 10.00
PubTator Score 13.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Protein-protein Interaction (7)

Gene RIF (13)

AA Sequence

MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPG      1 - 70
RPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR     71 - 140
KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT    141 - 210
IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP                                       211 - 245
//

Text Mined References (33)

PMID Year Title