Property Summary

NCBI Gene PubMed Count 25
PubMed Score 7.84
PubTator Score 13.59

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
non-small cell lung carcinoma 413
Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 9.49766725174064E-9
Amyotrophic Lateral Sclerosis 432 1.07772747406696E-7
posterior fossa group A ependymoma 1511 1.54508492889485E-6
pediatric high grade glioma 2712 1.43491281524277E-5
ovarian cancer 8492 1.53235473870531E-5
group 3 medulloblastoma 2254 1.62366534340995E-5
Breast cancer 3099 3.58833590791021E-5
medulloblastoma, large-cell 6234 3.8446109134949E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.30665896018978E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 6.90367689817289E-4
glioblastoma 5572 8.87693375753277E-4
dermatomyositis 967 9.20573181534807E-4
osteosarcoma 7933 0.00114513628425933
subependymal giant cell astrocytoma 2287 0.00191440964109195
Multiple myeloma 1328 0.00267217484802423
primitive neuroectodermal tumor 3031 0.00377726628740775
diabetes mellitus 1663 0.00396839888477158
astrocytic glioma 2241 0.022741776122779
Waldenstrons macroglobulinemia 765 0.0301410882533346
Disease Target Count Z-score Confidence
lung cancer 4473 0.0 2.0



Accession O60573 B8ZZJ9 O75349 eIF-4E type 2
Symbols 4EHP



2JGB   2JGC  

  Ortholog (15)

Gene RIF (11)

26370510 Tristetraprolin recruits eukaryotic initiation factor 4E2 (eIF4E2) to repress target mRNA translation.
25624349 DNA damage induces an increase in ARIH1 protein levels and association of ARIH1 with 4EHP. In turn, this causes 4EHP recruitment to the mRNA cap, where it is known to compete with eIF4E.
24408918 Activation of eIF4E2-directed translation is essential for cancer cells.
23991149 provide evidence that eIF4E2 binds 4E-T in the yeast two hybrid assay, as well as in pull-down assays and by recruitment to P-bodies in mammalian cells
22751931 GIGYF2 and the zinc finger protein 598 (ZNF598) are identified as components of the 4EHP complex.
21079520 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17369309 4EHP binds cap analogs m(7)GpppG and m(7)GTP with low affinity
17368478 4EHP plays a physiological role utilizing both cap-binding and protein-binding functions but which is distinct from eIF4E.
17289916 ISGylation of 4EHP may play an important role in cap structure-dependent translation control in immune responses.

AA Sequence

IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP                                       211 - 245

Text Mined References (30)

PMID Year Title
26370510 2015 Tristetraprolin Recruits Eukaryotic Initiation Factor 4E2 To Repress Translation of AU-Rich Element-Containing mRNAs.
25624349 2015 The E3 ubiquitin ligase ARIH1 protects against genotoxic stress by initiating a 4EHP-mediated mRNA translation arrest.
25416956 2014 A proteome-scale map of the human interactome network.
24408918 2014 Cancer cells exploit eIF4E2-directed synthesis of hypoxia response proteins to drive tumor progression.
23991149 2013 Investigating the consequences of eIF4E2 (4EHP) interaction with 4E-transporter on its cellular distribution in HeLa cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22751931 2012 A novel 4EHP-GIGYF2 translational repressor complex is essential for mammalian development.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.