Property Summary

NCBI Gene PubMed Count 23
PubMed Score 26.61
PubTator Score 43.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Barrett's esophagus 1.100 3.3e-02
esophageal adenocarcinoma 1.800 1.8e-02
psoriasis 2.000 3.1e-05
glioblastoma 1.700 3.1e-05
tuberculosis 1.200 1.4e-07
pediatric high grade glioma 1.500 1.7e-05
pilocytic astrocytoma 1.400 1.4e-06
ovarian cancer 2.000 4.1e-07

Gene RIF (10)

PMID Text
26380979 The study shows that lysyl hydroxylase 3 localizes to epidermal basement membrane and is reduced in patients with recessive dystrophic epidermolysis bullosa.
25825495 MMP-9 recruitment to the fibroblast cell surface by Lysyl Hydroxylase 3 (LH3) triggers TGF-beta activation and fibroblast differentiation
21465473 LH3 molecules found in the cell medium are secreted through the Golgi complex, and the secretion is dependent on LH3 glycosyltransferase activity; LH3 found on the cell surface bypasses the Golgi complex
20955792 Dimerization of human lysyl hydroxylase 3 is mediated by the amino acids 541-547
18834968 mutations of the lysyl hydroxylase 3 gene may cause a connective tissue disorder [case report]
18298658 The deficiency of LH3 glycosyltransferase activities, especially in the extracellular space, causes growth arrest.
18187620 Knockdown of procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 (PLOD3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16447251 LH3 is present and active in the extracellular space
12475640 Manipulation of the gene for LH3 can be used to selectively alter glycosylation and hydroxylation reactions, and provides new tool to clarify functions of unique hydroxylysine linked carbohydrates in collagens and other proteins.
11956192 Characterization of three fragments that constitute the monomers of the human lysyl hydroxylase isoenzymes 1-3. The 30-kDa N-terminal fragment is not required for lysyl hydroxylase activity

AA Sequence

MTSSGPGPRFLLLLPLLLPPAASASDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLG      1 - 70
LGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSA     71 - 140
ESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYLDPGLREKLSL    141 - 210
NLDHKSRIFQNLNGALDEVVLKFDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCG    211 - 280
FCNQDRRTLPGGQPPPRVFLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQL    281 - 350
QDHFSAVKLVGPEEALSPGEARDMAMDLCRQDPECEFYFSLDADAVLTNLQTLRILIEENRKVIAPMLSR    351 - 420
HGKLWSNFWGALSPDEYYARSEDYVELVQRKRVGVWNVPYISQAYVIRGDTLRMELPQRDVFSGSDTDPD    421 - 490
MAFCKSFRDKGIFLHLSNQHEFGRLLATSRYDTEHLHPDLWQIFDNPVDWKEQYIHENYSRALEGEGIVE    491 - 560
QPCPDVYWFPLLSEQMCDELVAEMEHYGQWSGGRHEDSRLAGGYENVPTVDIHMKQVGYEDQWLQLLRTY    561 - 630
VGPMTESLFPGYHTKARAVMNFVVRYRPDEQPSLRPHHDSSTFTLNVALNHKGLDYEGGGCRFLRYDCVI    631 - 700
SSPRKGWALLHPGRLTHYHEGLPTTWGTRYIMVSFVDP                                    701 - 738
//

Text Mined References (26)

PMID Year Title
26380979 2015 Lysyl Hydroxylase 3 Localizes to Epidermal Basement Membrane and Is Reduced in Patients with Recessive Dystrophic Epidermolysis Bullosa.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25825495 2015 Recruitment of Matrix Metalloproteinase-9 (MMP-9) to the Fibroblast Cell Surface by Lysyl Hydroxylase 3 (LH3) Triggers Transforming Growth Factor-? (TGF-?) Activation and Fibroblast Differentiation.
25416956 2014 A proteome-scale map of the human interactome network.
21465473 2012 Lysyl hydroxylase 3 is secreted from cells by two pathways.
21269460 2011 Initial characterization of the human central proteome.
20955792 2011 Dimerization of human lysyl hydroxylase 3 (LH3) is mediated by the amino acids 541-547.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18834968 2008 A connective tissue disorder caused by mutations of the lysyl hydroxylase 3 gene.
18298658 2009 The glycosyltransferase activities of lysyl hydroxylase 3 (LH3) in the extracellular space are important for cell growth and viability.
16447251 2006 Lysyl hydroxylase 3 (LH3) modifies proteins in the extracellular space, a novel mechanism for matrix remodeling.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475640 2002 The third activity for lysyl hydroxylase 3: galactosylation of hydroxylysyl residues in collagens in vitro.
11956192 2002 Characterization of three fragments that constitute the monomers of the human lysyl hydroxylase isoenzymes 1-3. The 30-kDa N-terminal fragment is not required for lysyl hydroxylase activity.
11334715 2001 Complete genomic structure of mouse lysyl hydroxylase 2 and lysyl hydroxylase 3/collagen glucosyltransferase.
10934207 2000 Lysyl hydroxylase 3 is a multifunctional protein possessing collagen glucosyltransferase activity.
10686427 2000 Complete exon-intron organization of the gene for human lysyl hydroxylase 3 (LH3).
9724729 1998 Cloning and characterization of a third human lysyl hydroxylase isoform.
9582318 1998 Primary structure, tissue distribution, and chromosomal localization of a novel isoform of lysyl hydroxylase (lysyl hydroxylase 3)