Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
Funding $88,035.75
PubMed Score 26.61
PubTator Score 43.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Barrett's esophagus 1.100 0.033
esophageal adenocarcinoma 1.800 0.018
psoriasis 2.000 0.000
glioblastoma 1.700 0.000
tuberculosis 1.200 0.000
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.400 0.000
ovarian cancer 2.000 0.000

Synonym

Accession O60568 B2R6W6 Q540C3
Symbols LH3

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (10)

PMID Text
26380979 The study shows that lysyl hydroxylase 3 localizes to epidermal basement membrane and is reduced in patients with recessive dystrophic epidermolysis bullosa.
25825495 MMP-9 recruitment to the fibroblast cell surface by Lysyl Hydroxylase 3 (LH3) triggers TGF-beta activation and fibroblast differentiation
21465473 LH3 molecules found in the cell medium are secreted through the Golgi complex, and the secretion is dependent on LH3 glycosyltransferase activity; LH3 found on the cell surface bypasses the Golgi complex
20955792 Dimerization of human lysyl hydroxylase 3 is mediated by the amino acids 541-547
18834968 mutations of the lysyl hydroxylase 3 gene may cause a connective tissue disorder [case report]
18298658 The deficiency of LH3 glycosyltransferase activities, especially in the extracellular space, causes growth arrest.
18187620 Knockdown of procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 (PLOD3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16447251 LH3 is present and active in the extracellular space
12475640 Manipulation of the gene for LH3 can be used to selectively alter glycosylation and hydroxylation reactions, and provides new tool to clarify functions of unique hydroxylysine linked carbohydrates in collagens and other proteins.
11956192 Characterization of three fragments that constitute the monomers of the human lysyl hydroxylase isoenzymes 1-3. The 30-kDa N-terminal fragment is not required for lysyl hydroxylase activity

AA Sequence

MTSSGPGPRFLLLLPLLLPPAASASDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLG      1 - 70
LGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSA     71 - 140
ESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYLDPGLREKLSL    141 - 210
NLDHKSRIFQNLNGALDEVVLKFDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCG    211 - 280
FCNQDRRTLPGGQPPPRVFLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQL    281 - 350
QDHFSAVKLVGPEEALSPGEARDMAMDLCRQDPECEFYFSLDADAVLTNLQTLRILIEENRKVIAPMLSR    351 - 420
HGKLWSNFWGALSPDEYYARSEDYVELVQRKRVGVWNVPYISQAYVIRGDTLRMELPQRDVFSGSDTDPD    421 - 490
MAFCKSFRDKGIFLHLSNQHEFGRLLATSRYDTEHLHPDLWQIFDNPVDWKEQYIHENYSRALEGEGIVE    491 - 560
QPCPDVYWFPLLSEQMCDELVAEMEHYGQWSGGRHEDSRLAGGYENVPTVDIHMKQVGYEDQWLQLLRTY    561 - 630
VGPMTESLFPGYHTKARAVMNFVVRYRPDEQPSLRPHHDSSTFTLNVALNHKGLDYEGGGCRFLRYDCVI    631 - 700
SSPRKGWALLHPGRLTHYHEGLPTTWGTRYIMVSFVDP                                    701 - 738
//

Text Mined References (26)

PMID Year Title
26380979 2015 Lysyl Hydroxylase 3 Localizes to Epidermal Basement Membrane and Is Reduced in Patients with Recessive Dystrophic Epidermolysis Bullosa.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25825495 2015 Recruitment of Matrix Metalloproteinase-9 (MMP-9) to the Fibroblast Cell Surface by Lysyl Hydroxylase 3 (LH3) Triggers Transforming Growth Factor-? (TGF-?) Activation and Fibroblast Differentiation.
25416956 2014 A proteome-scale map of the human interactome network.
21465473 2012 Lysyl hydroxylase 3 is secreted from cells by two pathways.
21269460 2011 Initial characterization of the human central proteome.
20955792 2011 Dimerization of human lysyl hydroxylase 3 (LH3) is mediated by the amino acids 541-547.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...