Property Summary

NCBI Gene PubMed Count 136
PubMed Score 292.96
PubTator Score 248.84

Knowledge Summary

Patent (7,682)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
psoriasis 6685 9.70058250998268E-103
breast carcinoma 1614 6.36996308167095E-37
non-small cell lung cancer 2798 5.47568036825354E-32
Breast cancer 3099 2.11165969313746E-20
atypical teratoid/rhabdoid tumor 1095 7.62754582609169E-14
lung adenocarcinoma 2714 1.92421040654565E-12
glioblastoma 5572 3.54475723596644E-12
pediatric high grade glioma 2712 1.64789395104051E-8
group 3 medulloblastoma 2254 3.04284287606207E-8
posterior fossa group A ependymoma 1511 1.52417181576568E-7
medulloblastoma, large-cell 6234 3.43224726246952E-7
primitive neuroectodermal tumor 3031 3.68549391658433E-7
malignant mesothelioma 3163 7.57607222558706E-7
lung cancer 4473 1.84486380041791E-6
pancreatic cancer 2300 4.94159876299404E-6
adrenocortical carcinoma 1427 9.80378298243604E-6
nasopharyngeal carcinoma 1056 1.94480989219565E-5
Atopic dermatitis 944 4.80351877158444E-5
ovarian cancer 8492 5.2182800583197E-5
invasive ductal carcinoma 2950 8.79693284013753E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.18839194819159E-4
pituitary cancer 1972 2.4141153469543E-4
ductal carcinoma in situ 1745 2.7474747405845E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.76249181793556E-4
interstitial cystitis 2299 0.00745572730832878
cystic fibrosis and chronic rhinosinusitis 213 0.00797532281176432
Endometriosis 535 0.00919542324183228
Disease Target Count Z-score Confidence
Cancer 2346 4.463 2.2
Disease Target Count Z-score Confidence
Alternating exotropia 1 4.709 2.4
Mitral valve stenosis 10 3.391 1.7

Expression

Synonym

Accession O60566 B2R6U0 B4DL09 B4DLG3 O60501 O60627 O60758 O75389 Q59HH6 Q8WV50 Q96KM4
Symbols MVA1
SSK1
BUBR1
Bub1A
MAD3L
hBUBR1
BUB1beta

Gene

PDB

5LCW   4GGD   3SI5   2WVI   5JJA  

  Ortholog (8)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (94)

PMID Text
26191236 Data suggest that both BubR1 and SNCG may be promising predictive marker rather than prognostic marker in patients with breast cancer.
26151845 BubR1 knockdown significantly decreased cellular invasion but slightly affect cellular proliferation on both Ca9-22 and Cal-27 cells.
26148513 We show that kinetochore recruitment of BUBR1 and BUB3 by BUB1 is dispensable for SAC activation
25964054 BubR1 contributes to preventing premature aging. [review]
25936804 By sequestering PIDD at the kinetochore, BubR1 acts to delay PIDDosome formation until the next cycle, defining a new mechanism by which cells evade apoptosis during mitosis.
25789401 Suggest human papillomavirus E2 protein provokes BUBR1-dependent aneuploidy in HPV-induced cervical cancer.
25669885 The ABBA motif in cyclin A is required for its proper degradation in prometaphase through competing with BUBR1 for the same site on CDC20
25611342 Bub1, but not BubR1, enhances binding of Bub3 to phosphorylated kinetochores.
25605730 YAP constitutively associated with BubR1 (BUB1-related protein kinase), and knockdown of BubR1 relieved YAP-driven hyperactivation of the spindle checkpoint.
25505175 the BubR1M-Cdc20 interaction indirectly contributes to mitotic checkpoint complex homeostasis
More...

AA Sequence

MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYT      1 - 70
GNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYS     71 - 140
YLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTLLALEK    141 - 210
EEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENAD    211 - 280
EASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQ    281 - 350
PVMTPCKIEPSINHILSTRKPGKEEGDPLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVF    351 - 420
RKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKLQIASESQKIP    421 - 490
GMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAV    491 - 560
LKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKD    561 - 630
LPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKC    631 - 700
LQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKR    701 - 770
EYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYIN    771 - 840
CFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIV    841 - 910
DFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKL    911 - 980
SQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGKLTSPGALLFQ    981 - 1050
//

Text Mined References (151)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26191236 2015 Predictive and prognostic values of BubR1 and synuclein-gamma expression in breast cancer.
26151845 2015 BubR1 Acts as a Promoter in Cellular Motility of Human Oral Squamous Cancer Cells through Regulating MMP-2 and MMP-9.
26148513 2015 Dissecting the roles of human BUB1 in the spindle assembly checkpoint.
25964054 2015 BubR1 kinase: protection against aneuploidy and premature aging.
25936804 2015 An Inhibitor of PIDDosome Formation.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25789401 2015 Stranglehold on the spindle assembly checkpoint: the human papillomavirus E2 protein provokes BUBR1-dependent aneuploidy.
25669885 2015 The ABBA motif binds APC/C activators and is shared by APC/C substrates and regulators.
25611342 2015 A molecular basis for the differential roles of Bub1 and BubR1 in the spindle assembly checkpoint.
More...