Property Summary

NCBI Gene PubMed Count 106
PubMed Score 826.86
PubTator Score 119.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (32)

Disease log2 FC p
adult high grade glioma -1.600 3.2e-02
astrocytic glioma -1.700 7.6e-03
Astrocytoma, Pilocytic -1.500 1.2e-03
Atopic dermatitis -2.400 1.9e-03
Breast cancer 3.500 4.9e-02
cystic fibrosis 3.000 9.5e-03
Down syndrome 1.900 9.4e-04
ductal carcinoma in situ 1.800 2.1e-02
ependymoma -1.700 1.7e-02
gastric carcinoma 2.500 2.6e-02
glioblastoma -1.500 5.8e-03
group 3 medulloblastoma -1.600 2.6e-02
interstitial cystitis 3.700 1.9e-02
intraductal papillary-mucinous adenoma (... -3.500 3.9e-04
intraductal papillary-mucinous carcinoma... -3.300 1.0e-03
invasive ductal carcinoma 1.372 3.9e-02
lung adenocarcinoma 1.400 2.2e-06
lung cancer 1.500 1.9e-03
lung carcinoma 1.100 1.5e-06
malignant mesothelioma 5.900 1.1e-09
medulloblastoma, large-cell -2.400 1.3e-04
nasopharyngeal carcinoma 2.200 8.3e-04
non-small cell lung cancer 4.638 2.7e-23
oligodendroglioma -1.700 9.3e-03
pancreatic cancer 1.900 2.3e-03
Pick disease -1.900 7.4e-03
primary pancreatic ductal adenocarcinoma 3.352 7.8e-04
primitive neuroectodermal tumor -1.900 8.8e-03
progressive supranuclear palsy -2.400 7.8e-03
psoriasis -1.600 4.9e-03
subependymal giant cell astrocytoma -2.373 2.2e-02
ulcerative colitis 2.900 2.1e-03

Synonym

Accession O60565 Q52LV3 Q8N914 Q8N936
Symbols DRM
HMPS
MPSH
PIG2
CRAC1
CRCS4
DAND2
HMPS1
IHG-2
DUP15q
C15DUPq
GREMLIN
CKTSF1B1

Gene

PDB

5AEJ  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 CSPA Cell Line (2)

Gene RIF (87)

AA Sequence

MSRTAYTVGALLLLLGTLLPAAEGKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGRGQGRGTAMPG      1 - 70
EEVLESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQS     71 - 140
CSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD                              141 - 184
//

Text Mined References (106)

PMID Year Title