Property Summary

NCBI Gene PubMed Count 183
Grant Count 287
R01 Count 173
Funding $41,317,480.1
PubMed Score 148.07
PubTator Score 193.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 0.006
osteosarcoma 2.666 0.000
juvenile dermatomyositis 1.168 0.000
acute quadriplegic myopathy 1.135 0.000
primary pancreatic ductal adenocarcinoma 1.002 0.014
Pick disease 1.400 0.000
acute myeloid leukemia 1.600 0.030
ovarian cancer -1.700 0.000

Synonym

Accession O60563 A9XU13 E7EX76 O60581 CycT1
Symbols CCNT
CYCT1
HIVE1

Gene

PDB

4IMY   4OGR   4OR5   3BLH   3BLQ   3BLR   3LQ5   3MI9   3MIA   3MY1   3TN8   3TNH   3TNI   4BCF   4BCG   4BCH   4BCI   4BCJ   4EC8   4EC9   2PK2  

Gene RIF (488)

PMID Text
25909811 the introduction of HIV-1 Tat and Mg12+ ion resulted in the active site architectural characteristics of phosphorylated CDK9/cyclin T1 complex
25781978 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25781978 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25735922 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25731772 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25731772 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25731772 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25653431 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25496916 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25132562 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
More...

AA Sequence

MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFY      1 - 70
MIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESII     71 - 140
LQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNW    141 - 210
EIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSE    211 - 280
QTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHR    281 - 350
TSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY    351 - 420
AAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAA    421 - 490
DKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNKRPGDPKHSSQTSNLAHKTYS    491 - 560
LSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSLNFSFPSLPTMGQMPGHSSDTSGLSFSQPSC    561 - 630
KTRVPHSKLDKGPTGANGHNTTQTIDYQDTVNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISS    631 - 700
RSGNTDKPRPPPLPSEPPPPLPPLPK                                                701 - 726
//

Text Mined References (193)

PMID Year Title
25909811 2015 Determining the Functions of HIV-1 Tat and a Second Magnesium Ion in the CDK9/Cyclin T1 Complex: A Molecular Dynamics Simulation Study.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
25116364 2014 NUCKS1, a novel Tat coactivator, plays a crucial role in HIV-1 replication by increasing Tat-mediated viral transcription on the HIV-1 LTR promoter.
24515107 2014 Release of positive transcription elongation factor b (P-TEFb) from 7SK small nuclear ribonucleoprotein (snRNP) activates hexamethylene bisacetamide-inducible protein (HEXIM1) transcription.
24351800 2013 The cyclin-dependent kinase ortholog pUL97 of human cytomegalovirus interacts with cyclins.
23977272 2013 Polo-like kinase 1 inhibits the activity of positive transcription elongation factor of RNA Pol II b (P-TEFb).
23691059 2013 Mice transgenic for CD4-specific human CD4, CCR5 and cyclin T1 expression: a new model for investigating HIV-1 transmission and treatment efficacy.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23569210 2013 Inhibition of HIV-1 transcription and replication by a newly identified cyclin T1 splice variant.
23539624 2013 Histone deacetylase inhibitors (HDACis) that release the positive transcription elongation factor b (P-TEFb) from its inhibitory complex also activate HIV transcription.
More...