Property Summary

NCBI Gene PubMed Count 35
Grant Count 6
R01 Count 6
Funding $454,329
PubMed Score 12.79
PubTator Score 12.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
psoriasis -1.200 0.000
ependymoma -1.900 0.000
glioblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma -1.700 0.000
medulloblastoma, large-cell -2.100 0.011
primitive neuroectodermal tumor -1.300 0.025
Atopic dermatitis -1.100 0.002
lung cancer 1.200 0.005
breast carcinoma -1.300 0.001
fibroadenoma -1.400 0.022
adult high grade glioma -1.900 0.006
pilocytic astrocytoma -2.300 0.000
subependymal giant cell astrocytoma -1.976 0.012
Breast cancer -2.000 0.000
ductal carcinoma in situ -2.200 0.000
invasive ductal carcinoma -2.300 0.019
ulcerative colitis -1.600 0.000
ovarian cancer -1.400 0.000
head and neck cancer -1.200 0.000

Gene RIF (41)

PMID Text
26621918 ligand binding properties of the NMT/ACBD6 complex can explain how the NMT reaction can proceed in the presence of the very abundant competitive substrate, C(16)-CoA.
23184449 HIV-1 Matrix is myristoylated on its N-terminal glycine residue by N-myristoyltransferase, a chemical modification important for membrane targeting of Gag/Matrix, for facilitating Matrix multimerization, and for virus particle formation and budding
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19403686 HIV-1 Matrix is myristoylated on its N-terminal glycine residue by N-myristoyltransferase, a chemical modification important for membrane targeting of Gag/Matrix, for facilitating Matrix multimerization, and for virus particle formation and budding
18089753 Nef is preferentially myristoylated by NMT2, suggesting that selective inhibition of NMT2 may provide a novel means of blocking HIV virulence.
18089753 HIV-1 Matrix is myristoylated on its N-terminal glycine residue by N-myristoyltransferase, a chemical modification important for membrane targeting of Gag/Matrix, for facilitating Matrix multimerization, and for virus particle formation and budding
18089753 HIV-1 Matrix is myristoylated on its N-terminal glycine residue by N-myristoyltransferase, a chemical modification important for membrane targeting of Gag/Matrix, for facilitating Matrix multimerization, and for virus particle formation and budding
17568424 Disruption of the gene for NMT2 by a t(8;10) translocation in a male with hypogonadism.
More...

AA Sequence

MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSAS      1 - 70
DSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAI     71 - 140
EPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLL    141 - 210
QWHCGVRVSSNKKLVGFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQ    211 - 280
AVYTAGVVLPKPIATCRYWHRSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKS    281 - 350
VRELINTYLKQFHLAPVMDEEEVAHWFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKA    351 - 420
AYSFYNIHTETPLLDLMSDALILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDS    421 - 490
EKVGLVLQ                                                                  491 - 498
//

Text Mined References (38)

PMID Year Title
26621918 2016 Association of NMT2 with the acyl-CoA carrier ACBD6 protects the N-myristoyltransferase reaction from palmitoyl-CoA.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18089753 2008 N-Myristoyltransferase isozymes exhibit differential specificity for human immunodeficiency virus type 1 Gag and Nef.
More...