Property Summary

NCBI Gene PubMed Count 6
Grant Count 9
R01 Count 7
Funding $513,373.27
PubMed Score 3.34
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Mental depression 58 2.0

Expression

Gene RIF (2)

PMID Text
22306510 identified transcription factors FOXD2 and GABP that bind to specific elements in the promoter of the RhitH gene
12621056 FOXD2 is a physiological regulator which increases cAMP sensitivity and sets the threshold for cAMP-mediated negative modulation of T cell activation

AA Sequence

MTLGSCCCEIMSSESSPAALSEADADIDVVGGGSGGGELPARSGPRAPRDVLPHGHEPPAEEAEADLAED      1 - 70
EEESGGCSDGEPRALASRGAAAAAGSPGPGAAAARGAAGPGPGPPSGGAATRSPLVKPPYSYIALITMAI     71 - 140
LQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADM    141 - 210
FDNGSFLRRRKRFKRQPLPPPHPHPHPHPELLLRGGAAAAGDPGAFLPGFAAYGAYGYGYGLALPAYGAP    211 - 280
PPGPAPHPHPHPHAFAFAAAAAAAPCQLSVPPGRAAAPPPGPPTASVFAGAGSAPAPAPASGSGPGPGPA    281 - 350
GLPAFLGAELGCAKAFYAASLSPPAAGTAAGLPTALLRQGLKTDAGGGAGGGGAGAGQRPSFSIDHIMGH    351 - 420
GGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGL    421 - 490
SGCHF                                                                     491 - 495
//

Text Mined References (8)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22306510 2012 Identification of Rhit as a novel transcriptional repressor of human Mpv17-like protein with a mitigating effect on mitochondrial dysfunction, and its transcriptional regulation by FOXD3 and GABP.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12621056 2003 A winged helix forkhead (FOXD2) tunes sensitivity to cAMP in T lymphocytes through regulation of cAMP-dependent protein kinase RIalpha.
9403061 1997 Cloning and characterization of freac-9 (FKHL17), a novel kidney-expressed human forkhead gene that maps to chromosome 1p32-p34.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.