Property Summary

NCBI Gene PubMed Count 24
PubMed Score 105.05
PubTator Score 13.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Glaucoma 135
Disease Target Count P-value
lung carcinoma 2844 1.20748201318436E-18
non-small cell lung cancer 2798 9.28416438873515E-10
tuberculosis 1563 1.66415804675103E-8
nasopharyngeal carcinoma 1056 9.79920183978239E-5
ovarian cancer 8492 3.88392053473018E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.96244837309282E-4
lung adenocarcinoma 2714 7.5937252539522E-4
Multiple myeloma 1328 8.66560010653996E-4
psoriasis 6685 0.00100395004835711
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00129975440988754
ulcerative colitis 2087 0.001462795292627
group 3 medulloblastoma 2254 0.00170601423241806
active Crohn's disease 918 0.00777806303779278
lung cancer 4473 0.00938364834677413
ductal carcinoma in situ 1745 0.0156184041227601
astrocytic glioma 2241 0.0287937377957152
spina bifida 1064 0.0423276091923021
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0446239063930155
Disease Target Count
BRACHYDACTYLY, TYPE E1 3

Expression

  Differential Expression (18)

Synonym

Accession O60547 E9PI88 O75357 Q5T954 Q6FH09 Q9UGZ3 Q9UJK9
Symbols GMD
SDR3E1

Gene

PANTHER Protein Class (2)

PDB

1T2A   5IN4   5IN5  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (11)

PMID Text
26382291 Disruptions of enhancers near FOXC1 and GMDS may influence brain development.
25173105 Data indicate three loci associated with primary open-angle glaucoma (POAG) were located upstream of ATP binding cassette transporter 1 (ABCA1), within actin filament associated protein 1 (AFAP1) and within GDP-mannose 46-dehydratase (GMDS).
23922970 These data demonstrate involvement of GMDS mutation in the progression of colorectal cancer.
23730929 Fx enzyme and GDP-L-Fuc Tr overexpression in the tumur tissue of colorectal cancer (CRC) patients suggests that GDP-L-Fuc transport to the Golgi apparatus may be an important factor associated with increased alpha(1,6)fucosylation in CRC.
22645305 GMD inhibits tankyrase 1 poly(ADP-ribose) polymerase activity in vitro, dependent on the GMD tankyrase 1 binding motif. In vivo, depletion of GMD led to degradation of tankyrase 1, dependent on the catalytic PARP activity of tankyrase 1.
22027835 Results indicate that GMDS regulates the formation of secondary complex II from the primary DISC independent of direct fucosylation of death receptors.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of GDP-mannose 4,6-dehydratase (GMDS) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19361506 Deficiency of GMDS leads to escape from natural killer cell-mediated tumor surveillance through modulation of TRAIL signaling.
More...

AA Sequence

MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYK      1 - 70
NPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVK     71 - 140
TCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHE    141 - 210
SPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHS    211 - 280
VREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVA    281 - 350
FDELVREMVHADVELMRTNPNA                                                    351 - 372
//

Text Mined References (27)

PMID Year Title
26382291 2016 Disruptions in a cluster of computationally identified enhancers near FOXC1 and GMDS may influence brain development.
25416956 2014 A proteome-scale map of the human interactome network.
25173105 2014 Common variants near ABCA1, AFAP1 and GMDS confer risk of primary open-angle glaucoma.
23922970 2013 Mutation of GDP-mannose-4,6-dehydratase in colorectal cancer metastasis.
23730929 2013 FX enzyme and GDP-L-Fuc transporter expression in colorectal cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22645305 2012 GDP-mannose-4,6-dehydratase is a cytosolic partner of tankyrase 1 that inhibits its poly(ADP-ribose) polymerase activity.
22027835 2011 GDP-mannose-4,6-dehydratase (GMDS) deficiency renders colon cancer cells resistant to tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor- and CD95-mediated apoptosis by inhibiting complex II formation.
22020760 2012 Polymorphic markers associated with severe oxaliplatin-induced, chronic peripheral neuropathy in colon cancer patients.
More...