Property Summary

NCBI Gene PubMed Count 25
PubMed Score 112.86
PubTator Score 13.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.167 7.8e-03
active ulcerative colitis 1.024 2.9e-03
astrocytic glioma -1.400 2.9e-02
ductal carcinoma in situ 1.100 1.6e-02
group 3 medulloblastoma 1.100 1.7e-03
intraductal papillary-mucinous adenoma (... 2.300 1.3e-03
intraductal papillary-mucinous carcinoma... 3.000 6.0e-04
intraductal papillary-mucinous neoplasm ... 1.200 4.5e-02
lung adenocarcinoma 1.205 7.6e-04
lung cancer 1.400 9.4e-03
lung carcinoma 1.600 1.2e-18
Multiple myeloma 1.491 8.7e-04
nasopharyngeal carcinoma -1.500 9.8e-05
non-small cell lung cancer 1.084 9.3e-10
ovarian cancer 1.500 3.9e-04
psoriasis 1.400 1.0e-03
spina bifida -1.018 4.2e-02
tuberculosis 1.900 1.7e-08

Synonym

Accession O60547 E9PI88 O75357 Q5T954 Q6FH09 Q9UGZ3 Q9UJK9
Symbols GMD
SDR3E1

Gene

PANTHER Protein Class (2)

PDB

1T2A   5IN4   5IN5  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (11)

AA Sequence

MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYK      1 - 70
NPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVK     71 - 140
TCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHE    141 - 210
SPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHS    211 - 280
VREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVA    281 - 350
FDELVREMVHADVELMRTNPNA                                                    351 - 372
//

Text Mined References (28)

PMID Year Title