Property Summary

NCBI Gene PubMed Count 24
Grant Count 29
R01 Count 3
Funding $6,959,396.99
PubMed Score 105.05
PubTator Score 13.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (11)

PMID Text
26382291 Disruptions of enhancers near FOXC1 and GMDS may influence brain development.
25173105 Data indicate three loci associated with primary open-angle glaucoma (POAG) were located upstream of ATP binding cassette transporter 1 (ABCA1), within actin filament associated protein 1 (AFAP1) and within GDP-mannose 46-dehydratase (GMDS).
23922970 These data demonstrate involvement of GMDS mutation in the progression of colorectal cancer.
23730929 Fx enzyme and GDP-L-Fuc Tr overexpression in the tumur tissue of colorectal cancer (CRC) patients suggests that GDP-L-Fuc transport to the Golgi apparatus may be an important factor associated with increased alpha(1,6)fucosylation in CRC.
22645305 GMD inhibits tankyrase 1 poly(ADP-ribose) polymerase activity in vitro, dependent on the GMD tankyrase 1 binding motif. In vivo, depletion of GMD led to degradation of tankyrase 1, dependent on the catalytic PARP activity of tankyrase 1.
22027835 Results indicate that GMDS regulates the formation of secondary complex II from the primary DISC independent of direct fucosylation of death receptors.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of GDP-mannose 4,6-dehydratase (GMDS) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19361506 Deficiency of GMDS leads to escape from natural killer cell-mediated tumor surveillance through modulation of TRAIL signaling.
More...

AA Sequence

MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYK      1 - 70
NPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVK     71 - 140
TCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHE    141 - 210
SPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHS    211 - 280
VREFVEKSFLHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVA    281 - 350
FDELVREMVHADVELMRTNPNA                                                    351 - 372
//

Text Mined References (27)

PMID Year Title
26382291 2016 Disruptions in a cluster of computationally identified enhancers near FOXC1 and GMDS may influence brain development.
25416956 2014 A proteome-scale map of the human interactome network.
25173105 2014 Common variants near ABCA1, AFAP1 and GMDS confer risk of primary open-angle glaucoma.
23922970 2013 Mutation of GDP-mannose-4,6-dehydratase in colorectal cancer metastasis.
23730929 2013 FX enzyme and GDP-L-Fuc transporter expression in colorectal cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22645305 2012 GDP-mannose-4,6-dehydratase is a cytosolic partner of tankyrase 1 that inhibits its poly(ADP-ribose) polymerase activity.
22027835 2011 GDP-mannose-4,6-dehydratase (GMDS) deficiency renders colon cancer cells resistant to tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) receptor- and CD95-mediated apoptosis by inhibiting complex II formation.
22020760 2012 Polymorphic markers associated with severe oxaliplatin-induced, chronic peripheral neuropathy in colon cancer patients.
More...