Property Summary

NCBI Gene PubMed Count 12
Grant Count 24
R01 Count 24
Funding $1,741,865.32
PubMed Score 19.98
PubTator Score 12.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.294 0.000

Gene RIF (6)

PMID Text
24375483 Results suggested that PSPN is a possible key regulator of oral squamous cell carcinoma (OSCC) progression via PSPN-RET-mitogen-activated protein kinase activation and that PSPN overexpression may have diagnostic potential for OSCC.
20350599 Results identify persephin, a GDNF family member, as a novel ligand for GFRalpha1/RET receptor complex.
18970938 No differences were found in the allelic frequencies of the variants or in the haplotype distribution between Hirschsprung's disease patients & controls, nor to any demographic/clinical parameters within the group of patients.
18970938 Observational study of gene-disease association. (HuGE Navigator)
15829225 The results obtained suggest the involvement of NTN, PSP, and ART in processes subserving both the organization of this cortical region during development and the functional activity and maintenance of the mature human hippocampal neurons.
15225646 Persephin/GFRalpha4 is unable to recruit RET protein into lipid rafts.

AA Sequence

MAVGKFLLGSLLLLSLQLGQGWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRRALSGPCQLWS      1 - 70
LTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHR     71 - 140
WQRLPQLSAAACGCGG                                                          141 - 156
//

Text Mined References (12)

PMID Year Title
24375483 2015 Persephin: A potential key component in human oral cancer progression through the RET receptor tyrosine kinase-mitogen-activated protein kinase signaling pathway.
20350599 2010 Persephin signaling through GFRalpha1: the potential for the treatment of Parkinson's disease.
18970938 2008 Polymorphisms in the genes encoding the 4 RET ligands, GDNF, NTN, ARTN, PSPN, and susceptibility to Hirschsprung disease.
15829225 2005 Neurturin, persephin, and artemin in the human pre- and full-term newborn and adult hippocampus and fascia dentata.
15225646 2004 PSPN/GFRalpha4 has a significantly weaker capacity than GDNF/GFRalpha1 to recruit RET to rafts, but promotes neuronal survival and neurite outgrowth.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11116144 2001 Human glial cell line-derived neurotrophic factor receptor alpha 4 is the receptor for persephin and is predominantly expressed in normal and malignant thyroid medullary cells.
10380959 1999 GDNF, RET and GFRalpha-1-3 mRNA expression in the developing human spinal cord and ganglia.
10072588 1998 Assignment of persephin (PSPN), a human neurotrophic factor, to chromosome 19p13.3 by radiation hybrid mapping and somatic cell hybrid PCR.
9740802 1998 GFR alpha-4 and the tyrosine kinase Ret form a functional receptor complex for persephin.
More...