Property Summary

NCBI Gene PubMed Count 12
PubMed Score 21.75
PubTator Score 12.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Bipolar Disorder 666
Disease Target Count P-value
osteosarcoma 7950 1.0e-09
Disease Target Count Z-score Confidence
Hirschsprung's disease 46 3.868 1.9
Parkinson's disease 392 3.439 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.042 1.0e-09

Gene RIF (6)

AA Sequence

MAVGKFLLGSLLLLSLQLGQGWGPDARGVPVADGEFSSEQVAKAGGTWLGTHRPLARLRRALSGPCQLWS      1 - 70
LTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHR     71 - 140
WQRLPQLSAAACGCGG                                                          141 - 156
//

Text Mined References (12)

PMID Year Title