Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.71
PubTator Score 8.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 1.1e-03
dermatomyositis 1.300 7.6e-04
glioblastoma -1.200 1.5e-05
hereditary spastic paraplegia -1.109 5.1e-03
intraductal papillary-mucinous adenoma (... 1.100 7.0e-03
osteosarcoma 1.098 2.9e-03
ovarian cancer -1.900 4.7e-07
Pick disease -1.400 2.4e-05
progressive supranuclear palsy -1.100 7.0e-03
psoriasis 1.100 6.3e-04
sonic hedgehog group medulloblastoma -1.200 1.7e-03
Waldenstrons macroglobulinemia 1.131 9.4e-03

Gene RIF (1)

AA Sequence

MKSRFSTIDLRAVLAELNASLLGMRVNNVYDVDNKTYLIRLQKPDFKATLLLESGIRIHTTEFEWPKNMM      1 - 70
PSSFAMKCRKHLKSRRLVSAKQLGVDRIVDFQFGSDEAAYHLIIELYDRGNIVLTDYEYVILNILRFRTD     71 - 140
EADDVKFAVRERYPLDHARAAEPLLTLERLTEIVASAPKGELLKRVLNPLLPYGPALIEHCLLENGFSGN    141 - 210
VKVDEKLETKDIEKVLVSLQKAEDYMKTTSNFSGKGYIIQKREIKPSLEADKPVEDILTYEEFHPFLFSQ    211 - 280
HSQCPYIEFESFDKAVDEFYSKIEGQKIDLKALQQEKQALKKLDNVRKDHENRLEALQQAQEIDKLKGEL    281 - 350
IEMNLQIVDRAIQVVRSALANQIDWTEIGLIVKEAQAQGDPVASAIKELKLQTNHVTMLLRNPYLLSEEE    351 - 420
DDDVDGDVNVEKNETEPPKGKKKKQKNKQLQKPQKNKPLLVDVDLSLSAYANAKKYYDHKRYAAKKTQKT    421 - 490
VEAAEKAFKSAEKKTKQTLKEVQTVTSIQKARKVYWFEKFLWFISSENYLIIGGRDQQQNEIIVKRYLTP    491 - 560
GDIYVHADLHGATSCVIKNPTGEPIPPRTLTEAGTMALCYSAAWDARVITSAWWVYHHQVSKTAPTGEYL    561 - 630
TTGSFMIRGKKNFLPPSYLMMGFSFLFKVDESCVWRHQGERKVRVQDEDMETLASCTSELISEEMEQLDG    631 - 700
GDTSSDEDKEEHETPVEVELMTQVDQEDITLQSGRDELNEELIQEESSEDEGEYEEVRKDQDSVGEMKDE    701 - 770
GEETLNYPDTTIDLSHLQPQRSIQKLASKEESSNSSDSKSQSRRHLSAKERREMKKKKLPSDSGDLEALE    771 - 840
GKDKEKESTVHIETHQNTSKNVAAVQPMKRGQKSKMKKMKEKYKDQDEEDRELIMKLLGSAGSNKEEKGK    841 - 910
KGKKGKTKDEPVKKQPQKPRGGQRVSDNIKKETPFLEVITHELQDFAVDDPHDDKEEQDLDQQGNEENLF    911 - 980
DSLTGQPHPEDVLLFAIPICAPYTTMTNYKYKVKLTPGVQKKGKAAKTALNSFMHSKEATAREKDLFRSV    981 - 1050
KDTDLSRNIPGKVKVSAPNLLNVKRK                                               1051 - 1076
//

Text Mined References (19)

PMID Year Title