Property Summary

NCBI Gene PubMed Count 16
Grant Count 2
Funding $298,752
PubMed Score 4.23
PubTator Score 4.69

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
22684010 4E-BP3 regulates eIF4E-mediated nuclear mRNA export and interacts with replication protein A2
21088106 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20621385 potential prognostic factor for survival in patients with lung adenocarcinoma
14557257 there are overlapping reading frames in the mouse and human genes for 4E-BP3 and MASK
14507920 PHAS-II, but not PHAS-III, contributes to the control of protein synthesis by insulin
12482586 4E-BP3 is associated with eIF4E in the cell nucleus and cytoplasm

AA Sequence

MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTP      1 - 70
PTAPLSKLEELKEQETEEEIPDDAQFEMDI                                             71 - 100
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22684010 2012 4E-BP3 regulates eIF4E-mediated nuclear mRNA export and interacts with replication protein A2.
21088106 2011 Associations between genetic variation in RUNX1, RUNX2, RUNX3, MAPK1 and eIF4E and riskof colon and rectal cancer: additional support for a TGF-?-signaling pathway.
20621385 2010 Prognostic significance of expression of eukaryotic initiation factor 4E and 4E binding protein 1 in patients with pathological stage I invasive lung adenocarcinoma.
19946888 2010 Defining the membrane proteome of NK cells.
17316564 2007 Binding preference of eIF4E for 4E-binding protein isoform and function of eIF4E N-terminal flexible region for interaction, studied by SPR analysis.
16271312 2005 Structural basis for mRNA Cap-Binding regulation of eukaryotic initiation factor 4E by 4E-binding protein, studied by spectroscopic, X-ray crystal structural, and molecular dynamics simulation methods.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15153109 2004 Characterization of mammalian eIF4E-family members.
More...