Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.46
PubTator Score 3.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 1.066 8.3e-03
Astrocytoma, Pilocytic 1.600 6.4e-10
atypical teratoid/rhabdoid tumor 1.200 3.4e-05
chronic rhinosinusitis -1.394 1.0e-02
Endometriosis -1.320 1.1e-02
ependymoma 1.400 2.1e-11
glioblastoma 1.300 2.5e-07
interstitial cystitis -1.200 6.7e-05
intraductal papillary-mucinous adenoma (... 2.000 2.3e-03
intraductal papillary-mucinous carcinoma... 1.900 1.8e-02
intraductal papillary-mucinous neoplasm ... 2.200 1.2e-02
lung cancer 1.200 7.2e-04
non-small cell lung cancer 1.799 3.1e-16
osteosarcoma -1.854 3.1e-08
ovarian cancer -1.200 1.0e-04
pancreatic cancer 1.200 8.3e-06
pediatric high grade glioma 1.400 6.9e-08
psoriasis -1.100 1.7e-03

Protein-protein Interaction (6)

Gene RIF (7)

AA Sequence

MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTK      1 - 70
KVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYL     71 - 140
LEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEE    141 - 210
HPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPE    211 - 280
VGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA          281 - 344
//

Text Mined References (12)

PMID Year Title