Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.92
PubTator Score 8.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.376 0.002
ductal carcinoma in situ 1.100 0.001
invasive ductal carcinoma 1.100 0.002
ovarian cancer 1.700 0.000

Synonym

Accession O60512 D3DVG3 O60910 Q9BPZ4 Q9H8T2 Beta-1,4-GalTase 3
Symbols beta4Gal-T3

Gene

Gene RIF (12)

PMID Text
26987623 our findings evidenced that B4GALT3 upregulated by miR-27a contributes to the tumorigenic activities by b1-integrin pathway and might provide potential biomarkers for cervical cancer.
25659296 Data suggest that expression of B4GALT3 in placenta is up-regulated in third trimester; over-expression of B4GALT3 in cultured trophoblasts suppresses cell migration; thus, B4GALT3 appears to regulate trophoblast invasion in late stages of pregnancy.
24403309 beta-1,4-Galactosyltransferase III suppresses beta1 integrin-mediated invasive phenotypes and negatively correlates with metastasis in colorectal cancer.
23444218 beta-1,4-Galactosyltransferase III enhances invasive phenotypes via beta1-integrin and predicts poor prognosis in neuroblastoma.
22082156 Knockdown of UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (B4GALT3) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
18565761 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
17613536 B4GALT3, DAP3, RGS16, TMEM183A and UCK2--were significantly overexpressed in dup(1q)-positive ALLs compared with high hyperdiploid ALLs without dup(1q).
2829950 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
2649653 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
2542563 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
More...

AA Sequence

MLRRLLERPCTLALLVGSQLAVMMYLSLGGFRSLSALFGRDQGPTFDYSHPRDVYSNLSHLPGAPGGPPA      1 - 70
PQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCEPRSRTAIIVPHRAREHHLRL     71 - 140
LLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCD    141 - 210
PRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPP    211 - 280
TSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPR    281 - 350
APSGPRYPPGSSQAFRQEMLQRRPPARPGPLSTANHTALRGSH                               351 - 393
//

Text Mined References (15)

PMID Year Title
26987623 2016 B4GALT3 up-regulation by miR-27a contributes to the oncogenic activity in human cervical cancer cells.
25659296 2015 ?-1,4-Galactosyltransferase III suppresses extravillous trophoblast invasion through modifying ?1-integrin glycosylation.
24403309 2014 ?-1,4-Galactosyltransferase III suppresses ?1 integrin-mediated invasive phenotypes and negatively correlates with metastasis in colorectal cancer.
23444218 2013 ?-1,4-Galactosyltransferase III enhances invasive phenotypes via ?1-integrin and predicts poor prognosis in neuroblastoma.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17613536 2007 Tiling resolution array comparative genomic hybridization, expression and methylation analyses of dup(1q) in Burkitt lymphomas and pediatric high hyperdiploid acute lymphoblastic leukemias reveal clustered near-centromeric breakpoints and overexpression of genes in 1q22-32.3.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...